DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6168 and H27A22.1

DIOPT Version :9

Sequence 1:NP_001287032.1 Gene:CG6168 / 39273 FlyBaseID:FBgn0036154 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001041144.1 Gene:H27A22.1 / 179482 WormBaseID:WBGene00010418 Length:356 Species:Caenorhabditis elegans


Alignment Length:353 Identity:120/353 - (33%)
Similarity:190/353 - (53%) Gaps:24/353 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WRSFIALICLAIIVVVITICQSFHTNFLTVGRNGTLRYEPTELNLGQMRMIAGLSDPENLRKNVQ 68
            ||....|:.||:::.::....|....:.|..|...|...|....|   |:....::....::.:.
 Worm     8 WRLIFVLMGLALVLGILICTTSAWGQWRTNQRTHQLSLLPESSTL---RLCRDFTNTTRFKEILA 69

  Fly    69 RIAIKRAVSTPGHSEVRNYIVDYLKKLNWNVELDIFTQKVPIMSNVTFHNIVARQNPQTQRYLMF 133
            .|.:.|.|.|..|.:|.:|:..:|..|.:..|.|.||...|:.:. .|.|::|..:....|.|:.
 Worm    70 PIMVPRIVDTKQHRQVGDYLQSFLHNLGFATEWDAFTDTTPLGTR-NFRNLIATFDESAPRRLVL 133

  Fly   134 GCHYDSKYFKDFDFMAATDSAVPCALMLNMA-TILKHQFHR--SQVSLMLVFFDGEEAFGEWSQE 195
            .||||||.......:||||||||||:||::| |:..:.:.|  .|:.|.|:||||||||.:|:..
 Worm   134 ACHYDSKIIPGQVMIAATDSAVPCAMMLDIAQTLAPYMYKRVAQQIGLQLIFFDGEEAFRDWTAT 198

  Fly   196 DSPYGSRHLAELWEKHGF--------------LDKIDLFVLPDLIGAKDVVFKKNI-LDTSGWFH 245
            ||.|||||||:.||:..:              ||:||:.:|.||:||.:......| :..:..|.
 Worm   199 DSLYGSRHLAQKWEQKWYPSSSSLNNFELSKELDRIDVLMLLDLLGAANPSIGNTIGMGANDLFS 263

  Fly   246 RLVQLELKLFQAGIVRS-ERPLFKFEPGID-VDDDHLPFTRRNVPVIHLISNKYPAVWHQAEDVE 308
            :|..:|..|..:|.:.| .|.:|..:...: |:|||:||.:|.||::|||:..:|:|||::.|..
 Worm   264 QLADVESNLRTSGCLSSLRRNVFNKQLSYNQVEDDHIPFLKRGVPILHLITVPFPSVWHRSSDNA 328

  Fly   309 MNVDYNTTEQVGLVLRMFVMEYLNSAPS 336
            ..:.|.|.:.:..|:|:||.:||..||:
 Worm   329 NALHYPTIDHMTAVIRVFVAKYLGIAPA 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6168NP_001287032.1 M28_QC_like 49..330 CDD:193501 105/300 (35%)
H27A22.1NP_001041144.1 M28_QC_like 50..350 CDD:349876 106/303 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.