DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7573 and OMA1

DIOPT Version :9

Sequence 1:NP_729695.2 Gene:CG7573 / 39272 FlyBaseID:FBgn0036153 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_013013.2 Gene:OMA1 / 853962 SGDID:S000001795 Length:345 Species:Saccharomyces cerevisiae


Alignment Length:159 Identity:34/159 - (21%)
Similarity:58/159 - (36%) Gaps:45/159 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 NDEQLAAFVAHQLAHWQLWHVAKGLALIYFYLLIYLLLFGICN-RWITLYAAAGFTTFYPSS--- 381
            ||:.:|..:||:.||....|.|:.|:....|.|:.|:|:.:.. ..|......||... |:|   
Yeast   193 NDDGIATVLAHEFAHQLARHTAENLSKAPIYSLLGLVLYTVTGAHAINNILLDGFLRM-PASRQM 256

  Fly   382 ------VGFWLVYKYLMPIYHDISTWIVFFCIRHFEYAA--DAYVNRRGYGLPMRAALLKLFSDD 438
                  :|..::.:........|..|         |..|  :..:||.|                
Yeast   257 ETEADYIGLMIMSRACFQPQESIKVW---------ERMANFEKQMNRGG---------------- 296

  Fly   439 YEFPYVDQCYLMWHRLRPSVLQRIDNLQR 467
                .|:..:|..|   |:..:||:|:.:
Yeast   297 ----VVNMEFLSTH---PASTRRIENMSK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7573NP_729695.2 Peptidase_M48_N 62..240 CDD:293100
Peptidase_M48 <320..466 CDD:299867 34/156 (22%)
OMA1NP_013013.2 M48C_Oma1_like 132..323 CDD:320690 34/159 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.