DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7573 and AT3G27110

DIOPT Version :10

Sequence 1:NP_729695.2 Gene:CG7573 / 39272 FlyBaseID:FBgn0036153 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_566808.1 Gene:AT3G27110 / 822330 AraportID:AT3G27110 Length:344 Species:Arabidopsis thaliana


Alignment Length:34 Identity:11/34 - (32%)
Similarity:18/34 - (52%) Gaps:3/34 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 LNDEQLAAFVAHQLAHWQLWHVAKGLALIYFYLL 353
            |...:|.|.:||:|.|.:..|   |:.|.:..:|
plant   180 LTSAELQAVLAHELGHLKCDH---GVWLTFANIL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7573NP_729695.2 Peptidase_M48_M56 42..467 CDD:333718 11/34 (32%)
AT3G27110NP_566808.1 M48_Ste24p_like 116..321 CDD:320684 11/34 (32%)

Return to query results.
Submit another query.