DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7573 and ste24c

DIOPT Version :9

Sequence 1:NP_729695.2 Gene:CG7573 / 39272 FlyBaseID:FBgn0036153 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001027433.1 Gene:ste24c / 3772676 FlyBaseID:FBgn0050462 Length:456 Species:Drosophila melanogaster


Alignment Length:440 Identity:135/440 - (30%)
Similarity:231/440 - (52%) Gaps:7/440 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DPILLRHILCLVIVVHNSFHLILCCRQLKLCKRTSVPPKQMEGILSQEAFQASKDKQLHASSLEI 100
            |||::..:|||:::|...:.:||..||..:|....:.|:::.||:..|.:..::..:||.:.|:|
  Fly    11 DPIIVLVVLCLIVLVDRIWEMILTKRQQLVCLNAIMVPEELRGIIPPEIYHRARIYELHKTELQI 75

  Fly   101 FNIAIDTLYSCLDLYLCTLAFLWKLTVGWYHYADS--TWLNVTFMTVFSTYLVVRKLPSLFYEKL 163
            :...||.:.:..:|.|....|||.|:........|  .|:.:.|:...:.|:.:|.||.|.|:|.
  Fly    76 WKYLIDLIITLCELILGFYPFLWSLSAKTLQKITSQEIWITLIFVFYLTIYICIRFLPVLIYDKC 140

  Fly   164 VLDPRYNVDPEKTPPLLGLICALVFVVVFLQVAVIPLTAIFMAIHMLSEWYFTLFVWLGLVGLSV 228
            :|:.||.:. .|.|..| ..|.....::..|:.:.||.|..:.......:||.|:.||.....::
  Fly   141 LLELRYGMS-GKFPWYL-YCCIGAMSILLSQLVLFPLAAAIVFSVKFIGYYFFLWFWLFWATFTL 203

  Fly   229 LVLAFVGLFGVPCLGKSRKM-NSTDMDNSLKAVLDDFNFP-GRVYMVHTFHVGRPTAWVMGCCCC 291
            |::.|:....:||:|:...: ..|.:...:|.|.|...|| .||:::.|..:....|:..|.||.
  Fly   204 LLVFFLPYCCIPCIGRQVVLPEGTALYMEVKRVCDVVGFPMKRVFIIKTRTMQYSNAYFYGSCCL 268

  Fly   292 LRLDIHDNLKWNRGFSSDDFDWGQMGAGLNDEQLAAFVAHQLAHWQLWHVAKGLALIYFYLLIYL 356
            .|:.|.|.|..|:|...::....::|.||.:.|:|..|.|:|.||:..|..|...::..:..|.:
  Fly   269 KRIVIFDTLLLNKGKEPNEIHPYEVGRGLTNIQVAGVVCHELGHWKHGHFYKATIIMKIHFFITM 333

  Fly   357 LLFGICNRWITLYAAAGFTT-FYPSSVGFWLVYKYLMPIYHDISTWIVFFCIRHFEYAADAYVNR 420
            .|||:......||.|.||.. ..|..|||.:|.|:.:..|..::..::.:.:|.||||||.:.:|
  Fly   334 GLFGLFFHSPQLYMAVGFEPGVMPIIVGFIIVLKFALTPYLTLANVLMLWNLRRFEYAADKFAHR 398

  Fly   421 RGYGLPMRAALLKLFSDDYEFPYVDQCYLMWHRLRPSVLQRIDNLQRLNM 470
            .||.:.:|.||:|:::|...||..||||..||...|::|||:...|:|::
  Fly   399 MGYSIQLRMALVKIYADHMSFPVYDQCYARWHHTHPTILQRLAYQQKLDV 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7573NP_729695.2 Peptidase_M48_N 62..240 CDD:293100 46/179 (26%)
Peptidase_M48 <320..466 CDD:299867 53/146 (36%)
ste24cNP_001027433.1 Peptidase_M48_N 37..215 CDD:293100 46/179 (26%)
HtpX 131..452 CDD:223575 102/320 (32%)
Peptidase_M48 229..441 CDD:299867 73/211 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450186
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002450
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10120
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.