DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7573 and Oma1

DIOPT Version :9

Sequence 1:NP_729695.2 Gene:CG7573 / 39272 FlyBaseID:FBgn0036153 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001100139.1 Gene:Oma1 / 298282 RGDID:1304821 Length:504 Species:Rattus norvegicus


Alignment Length:407 Identity:79/407 - (19%)
Similarity:141/407 - (34%) Gaps:128/407 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LTVGWYHYADSTWLNVTFMTVFSTYLVVRKLPSLFYEKLVLDPRYNVDPEKTP-PLLGLIC---- 184
            ||..|..:.|:        :....|..:|::.| |:...   ||     :..| |||.||.    
  Rat    90 LTYNWTVWGDA--------SCSPNYAAIREVRS-FHTSA---PR-----QAAPVPLLMLILKPVQ 137

  Fly   185 ALVFVVV------FLQVAVIPLTAIFMAIHMLSEWYFTLFVWLGLVGLSVLVLAFVGLFGVPCLG 243
            .|:.::|      :.|.......|:|......::|  .|.:.|...||..:|..|..|...|..|
  Rat   138 KLLAIIVGRGIRKWWQALPPDKKALFKDSVKRNKW--RLLLGLSAFGLLFVVFYFTHLEVSPVTG 200

  Fly   244 KS----------RKMNSTDMDNSLKAVLDDF-----------------------NFPGRV---YM 272
            :|          |.::..:.:..::...:|.                       :.||..   ::
  Rat   201 RSKLLLVGKEHFRLLSDLEYEVWMEEFKNDLLPEEDPRYLTVKKVVYHLTQCNQDVPGVSEINWV 265

  Fly   273 VHTFHVGRPTAWVMGCCCCLRLDIHDNLKWNRGFSSDDFDW-GQMGAGLNDEQLAAFVAHQLAHW 336
            ||..|..:..|:|:.                   :...|.: |.:.:..:..||:..:.|::||.
  Rat   266 VHVVHSPKVNAFVLP-------------------NGQVFVFTGLLNSVTDMHQLSFLLGHEIAHA 311

  Fly   337 QLWHVAKGLALIY---FYLLIYL-LLFGICNRWITLYAAAGFTTFYPSSVGFWLVYKYLMPIYHD 397
            .|.|.|:..:|::   |..:|:| :::.||.|...            :.:|.|:..| |.....|
  Rat   312 VLGHAAEKASLVHLLDFLGMIFLTMIWAICPRDSL------------AVLGQWIQSK-LQEYMFD 363

  Fly   398 ISTWIVFFCIRHFEYAADAYVNRRGYGLPMRAAL----LKLFSDDYEF-------PYVDQCYLMW 451
                      |.:....:|..::.|..|..:|.:    ..:|....||       |.:.:    |
  Rat   364 ----------RPYSRTLEAEADKIGLQLAAKACVDVRASSVFWQQMEFSESLHGYPKLPE----W 414

  Fly   452 HRLRPSVLQRIDNLQRL 468
            ....||...|.:.|.||
  Rat   415 LSTHPSHGNRAEYLDRL 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7573NP_729695.2 Peptidase_M48_N 62..240 CDD:293100 29/125 (23%)
Peptidase_M48 <320..466 CDD:299867 33/160 (21%)
Oma1NP_001100139.1 Cardiolipin-binding. /evidence=ECO:0000250|UniProtKB:Q9D8H7 127..146 7/18 (39%)
Stress-sensor region. /evidence=ECO:0000250|UniProtKB:Q9D8H7 144..174 5/31 (16%)
Peptidase_M48 258..432 CDD:279743 44/220 (20%)
HtpX <264..434 CDD:223575 43/214 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.