DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6175 and CG12768

DIOPT Version :9

Sequence 1:NP_001261708.1 Gene:CG6175 / 39271 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster


Alignment Length:320 Identity:72/320 - (22%)
Similarity:117/320 - (36%) Gaps:92/320 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 NISAEDVK------TEI----IEHESELGMLDRRTSTPSPINYYKP-TDLTYNHRKRKAM-GVEH 344
            |::.|.|:      .||    :.||..||    .|...|...||.. ..|....|:||:. .::|
  Fly    50 NVNGERVQRTFTSLREIFRRELNHEKMLG----TTRFKSKWEYYDAMAFLKEVIRERKSRERIKH 110

  Fly   345 VVGALTLTPIKVVGGAVGAGTVGSAGHQQQQQHQQQQMNHSQLAFQALQQHFSHNHGLSLSHCNG 409
              |:|...|:          ..||:.:......:....|:|..|.....|:|:.:   ..::.|.
  Fly   111 --GSLDSAPV----------ATGSSNNNNNCVSRNSSNNNSSSAALDEYQYFAPS---DPNNPNN 160

  Fly   410 QPQQQQQQHQHQP-----------HHQQQQQQQALHLQHQQQQQHSSNMAQKRDRDRDLSTSNGN 463
            |||.|.:.....|           ......||||.|||..|.|...:..:.::   :.|.||..|
  Fly   161 QPQLQPEPKSSLPVTIPSLSLTLSQLPVALQQQAQHLQALQLQPDVTLTSLQK---QSLPTSLTN 222

  Fly   464 GNSSNTNNTS-LEPIATSSNCSSSSS---NNSAATP----PKPLLGGGGLSANHVDEYGVFGEYV 520
            ...:....|| .:.:::|.:||||.|   .:...:|    |:.::.|.|..|             
  Fly   223 ATPAPLAQTSPAQVLSSSRSCSSSPSIYIKDEPCSPAGGCPEEVMTGNGPEA------------- 274

  Fly   521 AITIRKLKT----SKSKIVVK-----------------HLI---NNLLYEAELGKYDHGM 556
              |.:||.|    :|.::..:                 |||   ||.|.:.:.|..:..:
  Fly   275 --TRKKLATIRPQTKQQLKARLQLPTPKNSSSYATSPPHLIINANNELIDTDAGDLEEDL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510
CG12768NP_001262229.1 MADF 12..100 CDD:214738 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D0D8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.