DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6175 and CG10904

DIOPT Version :9

Sequence 1:NP_001261708.1 Gene:CG6175 / 39271 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001286800.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster


Alignment Length:160 Identity:33/160 - (20%)
Similarity:64/160 - (40%) Gaps:38/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WSRSTILNFIEDYRRQRVLWDPNTKGYHIKQTKYEA-------LKLLSQKYGTEIRSIRSKIKSL 113
            |:|..|...||.||....||:..::.|..|..:.:|       |::....||       .|:.:|
  Fly    24 WTREKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLEITKHDYG-------KKVHNL 81

  Fly   114 RSSFHREHGKV-----LSGRNRGVIYQPMWFAYEAIRFI-------------LDGERDQDR---- 156
            |:.|:.|..|:     .||.:|.......|..::.:.|:             ..|::...:    
  Fly    82 RNQFNAELKKLERRLEESGGDRDSEKACRWEHFKTLMFLRSVIEPRPGYQQGAPGKKLVSKLDMC 146

  Fly   157 --DQDQDQDAETETEVDEKLALMHSLDLEQ 184
              |||.::.:::..|..|.:.:.:..::.|
  Fly   147 YPDQDVEKQSQSSIESLESMIIENDAEICQ 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 22/94 (23%)
CG10904NP_001286800.1 MADF 31..125 CDD:214738 23/100 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.