DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6175 and CG4004

DIOPT Version :9

Sequence 1:NP_001261708.1 Gene:CG6175 / 39271 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_727638.2 Gene:CG4004 / 32226 FlyBaseID:FBgn0030418 Length:359 Species:Drosophila melanogaster


Alignment Length:424 Identity:81/424 - (19%)
Similarity:140/424 - (33%) Gaps:167/424 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WSRSTILNFIEDYRRQRVLWDPNTKGYHIKQTKYEA----LKLL--SQKYGTEIRSIRSKIKSLR 114
            |.:     |:..||....||...:|.|..:|.|.|:    |:||  :..| ..|.:::.||.:.|
  Fly    11 WKK-----FLGLYRSMPELWLVRSKLYRDRQLKLESYSRLLELLRTTDSY-ANIHTLKRKINNFR 69

  Fly   115 SSFHREHGKVLSGRNRGVIYQP-MWFAYEAIRFILDGERDQDRDQDQDQDAETETEVDEKLALMH 178
            :|:.||..|||...|   .|:| :|:..|                               |..::
  Fly    70 TSYRRELRKVLDSGN---TYKPTLWYFKE-------------------------------LDFLY 100

  Fly   179 SLDLEQLKADKLV--DRDIILQVEQQQQQHDELTARIAATVAAVAAAAAAANARDRERDVDTAGD 241
            .|:..:|:.:.:|  |||::...:..|.:.:: |....|.:|....:.:....|:.|.|.:...|
  Fly   101 ELETGELQLEGIVAADRDLVRNSKVLQNESNK-TITFGAQLAEQEVSMSFIVKREIEVDENITED 164

  Fly   242 MDTTRELELEEAAVGGGLIESSSAAVRLDWRVCIDFCTRSSSDLDGENYCNISAEDVKTEIIEHE 306
            |   ::||.|:.                                           |:.::...||
  Fly   165 M---QQLETEDV-------------------------------------------DIMSDAFPHE 183

  Fly   307 SELGMLDRRTSTPSPINYYKPTDLTYNHRKRKAMGVEHVVGALTLTPIKVVGGAVGAGTVGSAGH 371
            .::..||                                              |||.|.|     
  Fly   184 EDMLRLD----------------------------------------------AVGDGDV----- 197

  Fly   372 QQQQQHQQQQMNHSQLAFQALQQH---FSHNHGLSLSHCNGQPQQQQQQHQHQPHHQQQQQQQAL 433
                :.:.:..|..:|  ..:..|   :.:|........||  .||.....||.|:.:.|.....
  Fly   198 ----EPEPEPDNDPEL--DNMDDHVDDYRNNSSAGSIKNNG--YQQHTVSSHQQHNGESQTSDKS 254

  Fly   434 HLQHQQQQQHSSN------MAQKRDRDRDLSTSN 461
            ..:.:.:::.|||      .|:||   |::.|||
  Fly   255 GRRIRNRRRRSSNDTDYVEAARKR---RNVETSN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 29/89 (33%)
CG4004NP_727638.2 MADF_DNA_bdg 14..99 CDD:402258 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.