DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6175 and CG30403

DIOPT Version :9

Sequence 1:NP_001261708.1 Gene:CG6175 / 39271 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_726108.3 Gene:CG30403 / 246595 FlyBaseID:FBgn0050403 Length:302 Species:Drosophila melanogaster


Alignment Length:98 Identity:26/98 - (26%)
Similarity:48/98 - (48%) Gaps:22/98 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WSRSTILNFIEDYRRQRVLWDPNTKGYHIKQTKYEALKLLSQ---------KYGTEIRSIRSKIK 111
            :|....:.|:|.|.|:..||:   |..::::.:..|.:.:..         :.|..|:.::.|||
  Fly    16 FSDERTVKFVELYGREPCLWN---KRPYLRRARSAAYRRIQSGINADIEPYESGLTIQGVKMKIK 77

  Fly   112 SLRSSFHREHGKV--LSGRNRGVIYQPM--WFA 140
            :||:.:|:|..|:  :.|      |||.  |||
  Fly    78 NLRTGYHQELKKIRTIPG------YQPKTPWFA 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 25/90 (28%)
CG30403NP_726108.3 GT1 24..103 CDD:304916 22/87 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D0D8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.