DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6175 and CG5180

DIOPT Version :9

Sequence 1:NP_001261708.1 Gene:CG6175 / 39271 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001138087.1 Gene:CG5180 / 192508 FlyBaseID:FBgn0043457 Length:355 Species:Drosophila melanogaster


Alignment Length:507 Identity:110/507 - (21%)
Similarity:168/507 - (33%) Gaps:173/507 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DRVEWSRSTILNFIEDYRRQRVLWDPNTKGY--HIKQTK-YEAL--KLLSQKYGTEIRSIRSKIK 111
            |...:||..:..|||.|:.:..||.|....|  |..:.| |:.|  ||...:...:...:..||.
  Fly     4 DLRSYSRHWLTEFIEQYQEEECLWQPKHNDYSNHTARNKSYDRLVEKLKEVEPNPDRAMVVRKIN 68

  Fly   112 SLRSSFHREHGKVLSGRNRGVIYQPMWFAYEAIRFILDGERDQDRDQDQDQDAETETEVDEKLAL 176
            ||||:|.||..|.   ..:|.....:|: |:.:.||.|           .:....|.....|..|
  Fly    69 SLRSAFRREFRKT---STKGDYATRLWY-YDKLLFIAD-----------HKPKRHELGSKPKREL 118

  Fly   177 MHSLDLEQLKADKLVDRDIILQVEQQQQQHDELTARIAATVAAVAAAAAAANARDRERDVDTAGD 241
            ..|.|.|:             .:|.:...|.                 ....::..|..:.|:.|
  Fly   119 HISFDDEE-------------SMEFEDDSHH-----------------TGTQSQHMESIIPTSPD 153

  Fly   242 MDTTRELELEE-AAVGGGLIESSSAAVRLDWRVCIDFCTRSSSDLDGENYCNISAEDVKTEIIEH 305
                   ::|| ||....::.||..|            |.|:..:.......:    ||:|  ||
  Fly   154 -------DVEEVAATANNVVVSSQGA------------TLSTISVTPAECVTL----VKSE--EH 193

  Fly   306 ESELGMLDRRTSTPSPINYYKPTDLTYNHRKRKAMGVEHVVGALTLTPIKVVGGAVGAGTVGSAG 370
            :                                                     |..|....:..
  Fly   194 Q-----------------------------------------------------AAEAAAAAAQA 205

  Fly   371 HQQQQQHQQQQMNHSQLAFQALQQHFSHNHGLSLSHCNGQPQQQQQQHQHQPHHQQQQQQQALHL 435
            |||...|...|   :.:|..|.|.|......::....|.| ::.||...|..|||||     |||
  Fly   206 HQQMVAHAAAQ---TSIAAAAAQGHAVKVLEITSLDSNSQ-REIQQAVNHLEHHQQQ-----LHL 261

  Fly   436 QHQQQQQHSSNMAQKRDRDRDLSTSNGNGNSSNTNNTSLEPIATSSNCSSSSSNNSAATPPKPLL 500
            | |...||......:..||.                  .:|:  ..|..:::...:|||      
  Fly   262 Q-QTNGQHQGVPTIQIGRDH------------------YQPL--FGNAGTTAYTTTAAT------ 299

  Fly   501 GGGGLSANH--VDEYGVFGEYVAITIRKLKTSKSKIVVKHLINNLLYEAELG 550
                 |.:|  .|||...|..||..:|.:..:: :||.:.||:::|:.|:||
  Fly   300 -----STSHRQDDEYDAIGVNVASKLRSINPTQ-RIVAEKLISDVLFNAQLG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 27/87 (31%)
CG5180NP_001138087.1 MADF_DNA_bdg 16..100 CDD:287510 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.