DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scyl and Ddit4l

DIOPT Version :9

Sequence 1:NP_648456.2 Gene:scyl / 39270 FlyBaseID:FBgn0041094 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_084419.2 Gene:Ddit4l / 73284 MGIID:1920534 Length:193 Species:Mus musculus


Alignment Length:200 Identity:58/200 - (28%)
Similarity:96/200 - (48%) Gaps:28/200 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SSSIKHKQPAGSSNNNVGQSQSKKTKPSGSYNSNSNYYYYAADEEEGGSADYALSNYDKKAVEEL 131
            :.|:..|.||..|....|...      .||..|:.:|:.|...|          .|.::...||.
Mouse     4 TGSLSSKNPASISELLDGGYH------PGSLLSDFDYWDYVVPE----------PNLNEVVFEET 52

  Fly   132 S----LRLLDE-LRAAKSRHLTCTEVSLPCDLTPSVAREIIRVSEKEPRGIRGCTIYIEFEDEPK 191
            :    :::|:. |..:|...|.|::|.:|..||..:|::::|:|..||.|:|||.:::..|.| .
Mouse    53 TCQNLVKMLENCLSRSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIE-N 116

  Fly   192 NSRRIASIKVDSDTVSTFEVYLTLRQDHRGWTSLLP------QFMKSLARTITISPEYTITKNKL 250
            ..:::..|..|:..|.|||:.|..:|:...||||..      :|...|.||:.:|..:.:.|.||
Mouse   117 VCKKLDRIVCDASVVPTFELTLVFKQESCPWTSLKDFFFSRGRFSSGLKRTLILSSGFRLVKKKL 181

  Fly   251 YSADG 255
            ||..|
Mouse   182 YSLIG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scylNP_648456.2 RTP801_C 139..252 CDD:285100 39/118 (33%)
Ddit4lNP_084419.2 RTP801_C 65..183 CDD:285100 39/118 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837697
Domainoid 1 1.000 80 1.000 Domainoid score I8565
eggNOG 1 0.900 - - E1_28WN4
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5234
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004358
OrthoInspector 1 1.000 - - mtm8895
orthoMCL 1 0.900 - - OOG6_109004
Panther 1 1.100 - - LDO PTHR12478
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.750

Return to query results.
Submit another query.