DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scyl and DDIT4

DIOPT Version :9

Sequence 1:NP_648456.2 Gene:scyl / 39270 FlyBaseID:FBgn0041094 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_061931.1 Gene:DDIT4 / 54541 HGNCID:24944 Length:232 Species:Homo sapiens


Alignment Length:220 Identity:54/220 - (24%)
Similarity:102/220 - (46%) Gaps:24/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TSTTTSTSSSIKHKQPA---------GSSNNNVGQSQSKKTKPSGSYNSNSNYYYYAADEE---- 111
            :|::||:|.|...:.|.         ||:....|..:|...:.|...:.:|:...:..:|:    
Human     9 SSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEEDTAYL 73

  Fly   112 EGGS-ADYALSN--YDKKAVEELSLRLLDELRAAKSRHLTCTEVSLPCDLTPSVAREIIRVSEKE 173
            :|.| .|:.|.:  .|:.....|...|.:.|..|:........:.:|..|...|.:|::|::..|
Human    74 DGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSE 138

  Fly   174 PRGIRGCTIYIEFEDEPKNSRRIASIKVDSDTVSTFEVYLTLRQDHRGW-------TSLLPQFMK 231
            |.|:||..:.:..| :.|:...:..:.:|...|.||::.|.||.|.|.|       :|....|:.
Human   139 PCGLRGALLDVCVE-QGKSCHSVGQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLFSSANSPFLP 202

  Fly   232 SLARTITISPEYTITKNKLYSADGL 256
            ..::::|:|..:.:.|.||||::.|
Human   203 GFSQSLTLSTGFRVIKKKLYSSEQL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scylNP_648456.2 RTP801_C 139..252 CDD:285100 31/119 (26%)
DDIT4NP_061931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 13/61 (21%)
RTP801_C 104..223 CDD:400249 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147618
Domainoid 1 1.000 79 1.000 Domainoid score I8669
eggNOG 1 0.900 - - E1_28WN4
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5375
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588396at2759
OrthoFinder 1 1.000 - - FOG0004358
OrthoInspector 1 1.000 - - mtm8660
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12478
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6013
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.