DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scyl and ddit4

DIOPT Version :9

Sequence 1:NP_648456.2 Gene:scyl / 39270 FlyBaseID:FBgn0041094 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_989175.1 Gene:ddit4 / 394782 XenbaseID:XB-GENE-944276 Length:219 Species:Xenopus tropicalis


Alignment Length:197 Identity:53/197 - (26%)
Similarity:87/197 - (44%) Gaps:43/197 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SQSKKTKPSGSYNS--NSNYYYYAADEEEGGSADYALSNYDKKAVEELSL---RLLDE------- 138
            ||...:.||....|  :||.|                |..|..|.:|:||   .||::       
 Frog    35 SQRCSSLPSSDCESLTSSNSY----------------SECDLDAWDEISLPDSELLNDPEGEQLC 83

  Fly   139 ----------LRAAKSRHLTCTEVSLPCDLTPSVAREIIRVSEKEPRGIRGCTIYIEFEDEPKNS 193
                      |..||...|.|:.:.:|.:|..::.:|::.::..||.|:||..|.:..| ..|:.
 Frog    84 PSLLKLIKRCLTKAKINSLRCSRLLIPDELLCNLGQELLHLAYSEPCGLRGALIDLCVE-HGKDC 147

  Fly   194 RRIASIKVDSDTVSTFEVYLTLRQDHRGWTSLLPQF----MKSLARTITISPEYTITKNKLYSAD 254
            ..:|.|.||...|.||::.:.||.|.|.|..:...|    :....:::.:||.:.:.|.||||::
 Frog   148 HSVAQITVDQAVVPTFQLTVLLRLDSRLWPRIQGLFSTKPVPGSGQSLKLSPGFKVLKKKLYSSE 212

  Fly   255 GL 256
            .|
 Frog   213 EL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scylNP_648456.2 RTP801_C 139..252 CDD:285100 34/116 (29%)
ddit4NP_989175.1 RTP801_C 94..210 CDD:369532 34/116 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10125
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5226
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588396at2759
OrthoFinder 1 1.000 - - FOG0004358
OrthoInspector 1 1.000 - - mtm9556
Panther 1 1.100 - - O PTHR12478
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6013
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.