DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scyl and chrb

DIOPT Version :9

Sequence 1:NP_648456.2 Gene:scyl / 39270 FlyBaseID:FBgn0041094 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_648470.2 Gene:chrb / 39284 FlyBaseID:FBgn0036165 Length:299 Species:Drosophila melanogaster


Alignment Length:309 Identity:116/309 - (37%)
Similarity:153/309 - (49%) Gaps:65/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKMDVIAREQIIYGSLQGSNKNKDWTSRLPP-----------------------------PSAYT 36
            |||:|::.:..|.|.. |.||.|||.:...|                             ..|..
  Fly     1 MKMEVLSVQNHIQGKF-GVNKIKDWQASTAPLEEEEELTAGVNGNTAAGEGILDVDVVDGHPASV 64

  Fly    37 LDLMSKKAKTT---------------TGGSSNGSNATATSTTTSTSSSIKHKQPAGSS------- 79
            |.:...:|..|               .||.|.|......:|:...::|.:.....||:       
  Fly    65 LHMRQHQALNTRPSATPPSAGGGGPLAGGGSVGMTTPKQATSPVAAASFEAPLSGGSAAAYHHAY 129

  Fly    80 NNNV--GQSQSKKTKPSGSYNSNSNYYYYAADEEEGGSADYALSNYDKKAVEELSLRLLDELRAA 142
            ..||  ..:|.....|:....|.:...:.|||.         |.:....||.|||.:|..:||.|
  Fly   130 MTNVLSSTAQQHHPLPASPLQSTACARFGAADN---------LDDVSASAVRELSQQLQAQLRDA 185

  Fly   143 KSRHLTCTEVSLPCDLTPSVAREIIRVSEKEPRGIRGCTIYIEFEDEPKNSRRIASIKVDSDTVS 207
            |.|||.||||:||.|||..:|.||||:||:||.|.|.||::||||.||...:|||..|||.||||
  Fly   186 KRRHLACTEVTLPNDLTQRIAAEIIRMSEREPCGERACTLFIEFESEPNKVKRIAYFKVDPDTVS 250

  Fly   208 TFEVYLTLRQDHRGWTSLLPQFMKSLAR--TITISPEYTITKNKLYSAD 254
            .||:|||||||..||:||:|||:|:|.|  ||.|||::|:||.||||::
  Fly   251 IFELYLTLRQDKSGWSSLVPQFIKNLTRSNTINISPDFTLTKKKLYSSE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scylNP_648456.2 RTP801_C 139..252 CDD:285100 74/114 (65%)
chrbNP_648470.2 RTP801_C 182..297 CDD:285100 74/114 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449708
Domainoid 1 1.000 57 1.000 Domainoid score I10890
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5364
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588396at2759
OrthoFinder 1 1.000 - - FOG0004358
OrthoInspector 1 1.000 - - otm26257
orthoMCL 1 0.900 - - OOG6_109004
Panther 1 1.100 - - P PTHR12478
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.