DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scyl and ddit4

DIOPT Version :9

Sequence 1:NP_648456.2 Gene:scyl / 39270 FlyBaseID:FBgn0041094 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_956401.1 Gene:ddit4 / 378866 ZFINID:ZDB-GENE-031002-35 Length:220 Species:Danio rerio


Alignment Length:227 Identity:63/227 - (27%)
Similarity:102/227 - (44%) Gaps:39/227 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SSNGSNATATSTTTSTSSSIKHKQPAGSSNNNVGQSQSK---KTKPSGSYNSNSNYYYYAADEEE 112
            ||..|..::.||.||.:.:.:             .|.||   |...|.|.:|:|:.:....|..:
Zfish     7 SSLSSEDSSPSTPTSDAPAKR-------------LSWSKLMQKLHSSQSLDSDSDNHSSTDDSSD 58

  Fly   113 GGS---ADYALSNY--------DKKAVEELSLRLLDELRAAKSRHLTCTEVSLPCDLTPSVAREI 166
            .||   .|.:.|.:        .|:.|:.::|.|.|    ||...|.|:::.:|..|...:.:|:
Zfish    59 SGSICIPDVSQSEFFDPTEEALCKEVVQLIALNLTD----AKDGVLHCSKLLIPEKLLEHIGQEL 119

  Fly   167 IRVSEKEPRGIRGCTIYIEFEDEPKNSRRIASIKVDSDTVSTFEVYLTLRQDHRG-WTSLLPQF- 229
            :.:|..||.|:||..|.:..|.: .:....|.|.||...|.||::.|.||.|.|| |..:...| 
Zfish   120 VHLSVSEPCGLRGALIDLCVEQD-GSCHAAAQIAVDPYLVPTFQLTLVLRLDSRGLWPKIQGLFT 183

  Fly   230 -----MKSLARTITISPEYTITKNKLYSADGL 256
                 ..::.|.:.:|..:...|.||||::.|
Zfish   184 GRSPASPAVRRALRLSTGFRAIKRKLYSSEEL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scylNP_648456.2 RTP801_C 139..252 CDD:285100 35/119 (29%)
ddit4NP_956401.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 17/67 (25%)
RTP801_C 92..211 CDD:285100 37/123 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581426
Domainoid 1 1.000 57 1.000 Domainoid score I10890
eggNOG 1 0.900 - - E1_28WN4
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5364
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588396at2759
OrthoFinder 1 1.000 - - FOG0004358
OrthoInspector 1 1.000 - - otm26257
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12478
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6013
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.