DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scyl and Ddit4

DIOPT Version :9

Sequence 1:NP_648456.2 Gene:scyl / 39270 FlyBaseID:FBgn0041094 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_543182.1 Gene:Ddit4 / 140942 RGDID:621731 Length:229 Species:Rattus norvegicus


Alignment Length:221 Identity:54/221 - (24%)
Similarity:99/221 - (44%) Gaps:32/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TTSTSSSIKHKQPA---------GSSNNNVGQSQSKKTKPSGSYNSNSNYYYYAADEEEGGSADY 118
            ::|:|||...:.||         ||:....|..:....:.|...:.:|:...:..:|:.......
  Rat     9 SSSSSSSSSSRTPAADRPPRSAWGSAAREEGLDRCASLESSDCESLDSSNSGFGPEEDSSYLDGV 73

  Fly   119 ALSNY-------DKKAVEELSLRLLDELRAAKSRHLTCTEVSLPCDLTPSVAREIIRVSEKEPRG 176
            :|.::       |:.....|...|.:.|..|:........:.:|..|...|.:|::|::..||.|
  Rat    74 SLPDFELLSDPEDEHLCANLMQLLQESLSQARLGSRRPARLLMPSQLLSQVGKELLRLAYSEPCG 138

  Fly   177 IRGCTIYIEFEDEPKNSRRIASIKVDSDTVSTFEVYLTLRQDHRGW-----------TSLLPQFM 230
            :||..:.:..| :.|:...:|.:.:|...|.||::.|.||.|.|.|           :||:|.:.
  Rat   139 LRGALLDVCVE-QGKSCHSVAQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLLSSANSSLVPGYS 202

  Fly   231 KSLARTITISPEYTITKNKLYSADGL 256
            :||    |:|..:.:.|.||||::.|
  Rat   203 QSL----TLSTGFRVIKKKLYSSEQL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scylNP_648456.2 RTP801_C 139..252 CDD:285100 35/123 (28%)
Ddit4NP_543182.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68 12/58 (21%)
RTP801_C 101..220 CDD:285100 35/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5138
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588396at2759
OrthoFinder 1 1.000 - - FOG0004358
OrthoInspector 1 1.000 - - mtm9140
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12478
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.