DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scyl and ddit4l

DIOPT Version :9

Sequence 1:NP_648456.2 Gene:scyl / 39270 FlyBaseID:FBgn0041094 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_004911505.2 Gene:ddit4l / 101733493 XenbaseID:XB-GENE-6040115 Length:164 Species:Xenopus tropicalis


Alignment Length:174 Identity:55/174 - (31%)
Similarity:85/174 - (48%) Gaps:26/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 KPSGSYNSNSNYYYYAADEEEGGSADYALSNYDKKAVEELSLRLLDELRAAKSRHLTCTEVSLPC 156
            :|:|   |||..|:..|...:  .|...:..|      .|:..|.:.|..||...|.||::.:|.
 Frog     2 EPAG---SNSLEYFSNAMTVQ--DAFTVMRTY------HLASMLENCLYNAKCTKLHCTKILVPK 55

  Fly   157 DLTPSVAREIIRVSEKEPRGIRGCTIYIEFEDEPKNSRRIASIKVDSDTVSTFEVYLTLRQDHRG 221
            .|...||:||::.|..||.|:|||.:::..|...|: ..:.::..||....||||.|.|:::   
 Frog    56 GLLTRVAQEILKFSFTEPCGLRGCILHVNLECGHKH-LALGTLAYDSTVEPTFEVTLVLKRE--- 116

  Fly   222 WTSLLPQF---------MKSLARTI-TISPEYTITKNKLYSADG 255
             :.||..|         ..||.|.| .:||::.:|||.||.:.|
 Frog   117 -SQLLDHFSDFLIPGTWFPSLFRGILKLSPKFLLTKNSLYFSVG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scylNP_648456.2 RTP801_C 139..252 CDD:285100 42/122 (34%)
ddit4lXP_004911505.2 RTP801_C 41..155 CDD:400249 40/118 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10125
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5226
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588396at2759
OrthoFinder 1 1.000 - - FOG0004358
OrthoInspector 1 1.000 - - mtm9556
Panther 1 1.100 - - LDO PTHR12478
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.