DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68a and GluRIIE

DIOPT Version :9

Sequence 1:NP_648455.2 Gene:Ir68a / 39269 FlyBaseID:FBgn0036150 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_001036733.1 Gene:GluRIIE / 318623 FlyBaseID:FBgn0051201 Length:897 Species:Drosophila melanogaster


Alignment Length:527 Identity:98/527 - (18%)
Similarity:192/527 - (36%) Gaps:174/527 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 FQGVEVEIMNALGKALNFKPVYYKPNQTENMDWTELDGGASVAYGSGNPDGYAQNGTHIDSMLVD 308
            ::|..|:::..|...|.|             ::|.::||..  |||.|      ..|:..:.::.
  Fly   449 YEGYGVDLIKELADKLGF-------------NFTFVNGGND--YGSYN------KSTNESTGMLR 492

  Fly   309 EVAAHSARFAIGDLHLFQVYLKLVELSAPH-NFE-CLTFLTPESSTDNSWQTFILPFSAGMW--- 368
            |:....|..||.||.:.....:.::.:.|. |.. .:.:|.|:.:|...: ||:.|||..:|   
  Fly   493 EIMTGRADLAITDLTITSEREQALDFTIPFMNLGIAILYLKPQKATPELF-TFMDPFSEEVWWFL 556

  Fly   369 ----VGVLLSLFVVGTVFYAISFLNAIINGNVSSEF---FRCLRPNRNVPMDPKIYRRISFRIAI 426
                :||.||.|::|.:              ..||:   :.|:..                    
  Fly   557 GFSFLGVSLSFFILGRL--------------SPSEWDNPYPCIEE-------------------- 587

  Fly   427 SRYRSSKGDRMPRDLFDGYT--NCILLTYSMLLYVALPRMPRNWPLRVLTGWYWIYCILLVATYR 489
                       |.:|.:.:|  |.|..|...||.......|:....|.:..::|.:.:::|::|.
  Fly   588 -----------PEELENQFTLGNSIWFTTGALLQQGSEIGPKALSTRTVASFWWFFTLIVVSSYT 641

  Fly   490 ASFTAILANPAARVTIDTLEDLLRS-----HIPPSTGATENRQFFLEANDEVARKVGEKMEVFGY 549
            |:..|.|.....:..|::::||..:     :....||:|.|  ||:.:.:|..:|:.:.|.    
  Fly   642 ANLAAFLTIEKPQSLINSVDDLADNKDGVVYGAKKTGSTRN--FFMTSAEERYKKMNKFMS---- 700

  Fly   550 SDDLTSRIAKGQCAYYDNEFYL---------------RYLRVADESGSALHIMKECVL------- 592
                            :|..||               .|..:.:.:....:..:||.|       
  Fly   701 ----------------ENPQYLTEDNMEGVNRVKTNTHYAFLMESTSIEYNTKRECNLKKIGDAL 749

  Fly   593 ----YMPVVLAMEKNSALKPRVDASIQHLAEGGLIAK-----W----------LKDAIEHLPAEA 638
                |   .:||.|:...:.:.:.::..|.|.|::.|     |          .:||.:..|.: 
  Fly   750 DEKGY---GIAMRKDWPHRGKFNNALLELQEQGVLEKMKNKWWNEVGTGICATKEDAPDATPLD- 810

  Fly   639 LAQQEALMNIQKFW-----SSFVALLIGYVISMLTLLAERWHFKHIVMKHPMYDVYNPSLYY--- 695
                  :.|::..:     .|..|||.|.:..:|.::.:..|:     :.|:.|.......:   
  Fly   811 ------MNNLEGVFFVLLVGSCCALLYGIISWVLFVMKKAHHY-----RVPLRDALKEEFQFVID 864

  Fly   696 --NFKRI 700
              |:.|:
  Fly   865 FNNYVRV 871

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68aNP_648455.2 Lig_chan 429..661 CDD:278489 52/284 (18%)
GluRIIENP_001036733.1 PBP1_iGluR_Kainate 42..396 CDD:107377
ANF_receptor 51..382 CDD:279440
PBP2_iGluR_Kainate 419..790 CDD:270432 82/432 (19%)
Lig_chan 551..824 CDD:278489 58/349 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462707
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.