DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68a and GRIN3B

DIOPT Version :9

Sequence 1:NP_648455.2 Gene:Ir68a / 39269 FlyBaseID:FBgn0036150 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_619635.1 Gene:GRIN3B / 116444 HGNCID:16768 Length:1043 Species:Homo sapiens


Alignment Length:410 Identity:82/410 - (20%)
Similarity:142/410 - (34%) Gaps:106/410 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 LVDEVAAHSARFAIGDLHLFQVYLKLVELSAPHNFECLTFLTPESSTDNSWQTFILPFSAGMWVG 370
            ||.::.|..|..|:....:.....::|:.::|.....|..:.....|.:....|:.|.....|:|
Human   516 LVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLG 580

  Fly   371 VLLSLFVVGTVFYAISFLNAIINGNVSSEFFRCLRPNRNVPMDPKIYRRISFRIAISRYRSSKG- 434
            |           :|...|.|:.                               :.:..:||..| 
Human   581 V-----------FAALHLTALF-------------------------------LTVYEWRSPYGL 603

  Fly   435 ---DRMPRDLFDGYTNCILLTYSMLLYVAL----PRMPRNWPLRVLTGWYWIYCILLVATYRASF 492
               .|....:| .|::.:.|.|::|....:    |:.|..   |:|...:.|:|:|::::|.|:.
Human   604 TPRGRNRSTVF-SYSSALNLCYAILFRRTVSSKTPKCPTG---RLLMNLWAIFCLLVLSSYTANL 664

  Fly   493 TAILANPAARVTIDTLEDLLRSHIP---------------PSTGATENRQFFLEANDEVARKV-- 540
            .|::      |...|.|:|...|.|               .|:.....::.|.:.:..:.|..  
Human   665 AAVM------VGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRHSAP 723

  Fly   541 ----GEKMEVFGYSDDLTSRIAKGQCAYYDNEFYLRYLRVADESGSALHIMKECVL--YMPVVLA 599
                |..|        |||...|.. |:..::..|.|....|.....|.:.|...:  |   .:.
Human   724 TTPRGVAM--------LTSDPPKLN-AFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGY---GIG 776

  Fly   600 MEKNSALKPRVDASIQHLAEGGLI----AKWLKDAIEHLPA--EALAQQEAL-MNIQKFWSSFVA 657
            :.:||.|...:...|......|.|    .||.|    .:|.  ...|..|.| |:|..|...||.
Human   777 LPQNSPLTSNLSEFISRYKSSGFIDLLHDKWYK----MVPCGKRVFAVTETLQMSIYHFAGLFVL 837

  Fly   658 LLIGYVISMLTLLAERWHFK 677
            |.:|...::|:.|.|...|:
Human   838 LCLGLGSALLSSLGEHAFFR 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68aNP_648455.2 Lig_chan 429..661 CDD:278489 60/269 (22%)
GRIN3BNP_619635.1 PBP1_iGluR_NMDA_NR3 19..405 CDD:107372
PBP2_iGluR_NMDA_Nr3 415..808 CDD:270438 65/355 (18%)
Lig_chan 576..842 CDD:278489 66/333 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155887
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.