DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and MAGI2

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_016868329.1 Gene:MAGI2 / 9863 HGNCID:18957 Length:1540 Species:Homo sapiens


Alignment Length:180 Identity:42/180 - (23%)
Similarity:64/180 - (35%) Gaps:36/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SASGSAAGAVGGRATPEMKRSAVRSLIKRYFHQLQS-GCGNANCSNANCASSG-------KVAPM 74
            :|..|.|....|.|:..::.|.|      ..|:.:: |.|....|:.|...||       |:..:
Human   942 AAPSSNASPPEGFASHSLQTSDV------VIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRI 1000

  Fly    75 TPNEVAARALQLFSQDAQLCEAFTSEANSPQ-DVDML----------------SPNDSSSSSSGS 122
            .....|.|..:|...|..|.....|..|.|. |:..|                ..|..:|:.|..
Human  1001 IDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPSSE 1065

  Fly   123 STSTITSASTTTTTSRQSQSTPAAVVVPVSSPYLTQSVPQ-LDIAGAEHS 171
            ..|.:...|.....|..:|.:||....|::.|    :.|| |.:.|.|:|
Human  1066 KQSPMAQQSPLAQQSPLAQPSPATPNSPIAQP----APPQPLQLQGHENS 1111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 13/61 (21%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
MAGI2XP_016868329.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.