DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and BAG3

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_004272.2 Gene:BAG3 / 9531 HGNCID:939 Length:575 Species:Homo sapiens


Alignment Length:222 Identity:47/222 - (21%)
Similarity:82/222 - (36%) Gaps:44/222 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SPNDSSSSSSGSSTSTITSASTTTTTSRQSQSTPAAVVVPVSSPYLTQSVPQLD-IAGAEHSSGD 174
            ||..|:..||..|.:|...|:.:|..:..:...|.....|...|.:.:....|: :.|.|.:..:
Human   377 SPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHPGVLKVEAILEKVQGLEQAVDN 441

  Fly   175 SEPCTPTLAPVHSLDANSLIA---LYEQCRAADSYDRICHAIGVVFSSVDRLGKSFIRSAEPAAS 236
            .|.        ...|...|:.   |.::..|.|              |||..|::.:|.|.....
Human   442 FEG--------KKTDKKYLMIEEYLTKELLALD--------------SVDPEGRADVRQARRDGV 484

  Fly   237 SSLQELL-------ANSPGALNKEQLRTLEGEHDKDEDSTQQV-----DEQSESAANATATAESV 289
            ..:|.:|       .:.||.:...:|:....|.|:...:..::     |:..::|.|    ||..
Human   485 RKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGN----AEDP 545

  Fly   290 ESEAEPEEEDDDVCSSQSSDTLVDLPG 316
            .:|.:..|......|:.||  :.|.||
Human   546 HTETQQPEATAAATSNPSS--MTDTPG 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
BAG3NP_004272.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92
WW 21..53 CDD:197736
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..421 11/43 (26%)
BAG 421..498 CDD:214591 17/98 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..575 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.