DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and AT5G16040

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_197108.1 Gene:AT5G16040 / 831461 AraportID:AT5G16040 Length:396 Species:Arabidopsis thaliana


Alignment Length:256 Identity:50/256 - (19%)
Similarity:81/256 - (31%) Gaps:81/256 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GGGEDDQHLPGVSSASGSAA-----------GAVGG--------------------RAT----PE 34
            |.|||.|...|.......|:           ..|||                    |.|    ||
plant    11 GSGEDGQLGLGTDEEKELASVVDALEPFNVRSVVGGSRNSLAICDDGKLFTWGWNQRGTLGHPPE 75

  Fly    35 MKRSAVRSLIKRYFHQ--LQSGCGNANCSNANCASSGKVAPMTPNEVAARALQLFSQDAQLCEAF 97
            .|..:..||:|...:.  :|:..|..:|...:  ..|:......||        :.|..:  |..
plant    76 TKTESTPSLVKSLANVKIVQAAIGGWHCLAVD--DQGRAYAWGGNE--------YGQCGE--EPS 128

  Fly    98 TSEANSPQDVDMLSPNDSSSS------SSGSSTSTITSASTTTTTSRQSQSTPAAVVVPVSSPYL 156
            ..|...|...|::.|...:..      ::|.:.|.:.:......|  ..|..|...:..:|.|..
plant   129 KDETGRPVRRDIVIPKRCAQQLTVRQVAAGGTHSVVLTREGYVWT--WGQPWPPGDIKQISVPVR 191

  Fly   157 TQSVP--QLDIAGAEHS---------------------SGDSEPCTPTLAPVHSLDANSLI 194
            .|.:.  :|...||.|:                     :||::|.:..: ||..||..:|:
plant   192 VQGLENVRLIAVGAFHNLALKEDGTLWAWGNNEYGQLGTGDTQPRSYPI-PVQGLDDLTLV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 10/55 (18%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
AT5G16040NP_197108.1 ATS1 6..339 CDD:227511 50/256 (20%)
RCC1 320..385 CDD:395335
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1192
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.