DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and AT3G02510

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_186900.3 Gene:AT3G02510 / 821100 AraportID:AT3G02510 Length:393 Species:Arabidopsis thaliana


Alignment Length:258 Identity:50/258 - (19%)
Similarity:80/258 - (31%) Gaps:85/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GGGEDDQHLPG----------------------VSSASGSAA---------------GAVGGRAT 32
            |.|||.|...|                      ||.:..|.|               |.:|.:  
plant    11 GSGEDGQLGIGTNEEKEWACVVEALEPYSVRSVVSGSRNSLAICDDGTMFTWGWNQRGTLGHQ-- 73

  Fly    33 PEMKRSAVRSLIKRYFHQ--LQSGCGNANCSNANCASSGKVAPMTPNEVAARALQLFSQDAQLCE 95
            ||.|...:.|.:|...:.  .|:..|..:|...:  ..|:......||        :.|..:  |
plant    74 PETKTENIPSRVKALANVKITQAAIGGWHCLAVD--DQGRAYAWGGNE--------YGQCGE--E 126

  Fly    96 AFTSEANSPQDVDMLSPNDSSSS------SSGSSTSTITSASTTTTTSRQSQSTPAAVVVPVSSP 154
            ....|...|...|::.|...:..      ::|.:.|.:.:......|  ..|..|...:..:|.|
plant   127 PLKDEMGRPVRRDIVIPKRCAPKLTVRQVAAGGTHSVVLTREGHVWT--WGQPWPPGDIKQISVP 189

  Fly   155 YLTQSVP--QLDIAGAEHS---------------------SGDSEPCTPTLAPVHSLDANSLI 194
            ...|.:.  :|...||.|:                     :||::| |....||..||..:|:
plant   190 VRVQGLENVRLIAVGAFHNLALEEDGRLLAWGNNEYGQLGTGDTQP-TSHPVPVQGLDDLTLV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 9/55 (16%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
AT3G02510NP_186900.3 ATS1 6..387 CDD:227511 50/258 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1192
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.