DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and itch

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001072737.1 Gene:itch / 780194 XenbaseID:XB-GENE-976485 Length:853 Species:Xenopus tropicalis


Alignment Length:366 Identity:118/366 - (32%)
Similarity:199/366 - (54%) Gaps:26/366 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 LKLTVRRDQLINDALIGLEMVAMSNPKDLKKQLVVEFVGEQGIDEGGVSKEFFQLIVEEIFNPAF 684
            :|:||.|..|..|:   .:.:...|.:||:::|.:...||:|:|.|||::|:|.|:..|:.||.:
 Frog   498 VKITVNRKTLFEDS---FQQIMSFNAQDLRRRLWIIIPGEEGLDYGGVAREWFFLLSHEVMNPMY 559

  Fly   685 GMFIQQEETNN-MWFNATPFENG---AQFTLIGIIIGLAIYNNVTLAVNFPMVVYRKLIGYCGTF 745
            .:|....:.|. :..|...:.|.   ..|..||..|.:|:::...:...|.:..|::::......
 Frog   560 CLFEYAGKDNYCLQINPASYINPDHLRYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGL 624

  Fly   746 ADLSDWSPALYKSLKSMLDYQGQDMEEV-FEQTFKISYSDVFGDVVQHELVPNGQDVLVGQHNKE 809
            .||....|..|.||..:.|   .::||. .|..|.:. .::.|||..|:|.|:|.::.|.:.|||
 Frog   625 KDLESVDPEFYNSLIWIKD---NNIEECGLEMFFSVD-KEILGDVKSHDLKPDGSNIQVTEENKE 685

  Fly   810 LFVNLYSDFLLNTNIEQQFNAFRKGFEMVTDESPLKLLFRPEEIEMLVCGSREFDFVELENSTVY 874
            .::.|.:::.|:..:|:|..||.:||..:..:..|: .|..:|:|:|:||.:|.|..:.:.:|:|
 Frog   686 EYIRLVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQ-YFDAKELEVLLCGMQEIDLNDWQRNTIY 749

  Fly   875 EGGYTEKSQYIQDFWSIVHAMPSEDKHKLLEFTTGSARVPVGGLKCLRLLITRHGPD-------- 931
            . .||..|:.|..||..|..:.:|.:.:||:|.||:.|:||||...   |:..:||.        
 Frog   750 R-HYTRTSKQIIWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFAD---LMGSNGPQKFCIEKVG 810

  Fly   932 -SDRLPTSHTCFNVLLLPEYSSREKLEERLMKAINYSKGFG 971
             .:.||.||||||.|.||.|.|.|:|:|:|:.||..::|||
 Frog   811 KENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFG 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166
HECTc 620..971 CDD:238033 116/364 (32%)
HECTc 647..970 CDD:214523 108/336 (32%)
itchNP_001072737.1 C2_E3_ubiquitin_ligase 17..137 CDD:175988
WW 279..308 CDD:306827
HUL4 <310..853 CDD:227354 118/366 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.