DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and plekha7a

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001129715.1 Gene:plekha7a / 571486 ZFINID:ZDB-GENE-050419-75 Length:1197 Species:Danio rerio


Alignment Length:398 Identity:80/398 - (20%)
Similarity:127/398 - (31%) Gaps:123/398 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PMTPNE-VAARALQLFSQDAQLCEAFTSEANSPQDVDMLSPNDSSSSSSGSSTSTITSASTTTTT 136
            |.||.| |..|.|    :|..:.|  ...:|||..:                     .:..:.|.
Zfish   566 PHTPAERVTVRPL----EDRPIVE--VPPSNSPHRL---------------------RSYKSATI 603

  Fly   137 SRQSQSTPAAVVVPVSSP------------YLTQSVPQLD--IAGAEHSSGDSEPCTPTLAPVHS 187
            .|:|....|.:...||:|            :|.:.:..||  ::|.|...|  .|..|.......
Zfish   604 ERRSMPPSAYITHTVSAPSLRGKTADDTYMHLKKGLEYLDLKVSGTEALKG--RPAKPVKVAESD 666

  Fly   188 LDANSLIALYEQCRAADSYDRICHAIGVVFSSVDRLGKSFIRSAEPAASSSLQELLANSPGAL-N 251
            :|. :|..|.||       |:|                             ||||.....|.. :
Zfish   667 VDV-TLSRLCEQ-------DKI-----------------------------LQELEFRLSGLKDD 694

  Fly   252 KEQLRTL------EGEHDKDEDS-TQQVDEQ----SESAANATATAESVESEAEPEEEDDDVCSS 305
            |::|.::      :.|..||:.| |.::..|    .|...:..|....|.:|.| ...||.....
Zfish   695 KDKLESVLDVSHQQMEQYKDQPSHTDKIAYQQRLLQEDLVHIRADISRVSTEME-RAWDDYSGME 758

  Fly   306 QSSDTLVDLPGLRRVQRLLFGCQIRAITEKLTSSVIQLSDWVIYMRTDWERVIHCLVICFDLATN 370
            ||.:.|.|:     :|..:..|.......:|...:.::.|    :.|..........|..|...|
Zfish   759 QSVEQLRDV-----LQTQMTLCTSPQEKNQLKRELWRMED----VMTGLSSTKETFKITVDSVKN 814

  Fly   371 TNNSVVDMDYLDRVLPKLCQAASAMPVPAQARLARIWAAHCSDQLHSLIAACQQQITLQVLLDEE 435
            ....:|. ..::..:|..|...||..|.:..|              ||.::     .|.:.||.|
Zfish   815 PERKLVP-SVIESTVPSRCMTPSAAEVRSPQR--------------SLTSS-----PLSLPLDNE 859

  Fly   436 SMRENESI 443
            .:|....:
Zfish   860 DLRNRHPV 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 8/21 (38%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
plekha7aNP_001129715.1 WW 55..84 CDD:278809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..148
PH_PEPP1_2_3 153..256 CDD:270068
PH 159..255 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..384
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..467
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..577 5/10 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 830..928 12/57 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1032..1064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.