DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and wwtr1

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001032785.1 Gene:wwtr1 / 568008 ZFINID:ZDB-GENE-051101-1 Length:391 Species:Danio rerio


Alignment Length:279 Identity:54/279 - (19%)
Similarity:98/279 - (35%) Gaps:72/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SSGKVAPMTPNEVAARALQLFSQDAQLCEAFTSEAN----SPQDVDM----LSPNDSSSSSSGSS 123
            |...:.|:..::|...|..|   |..|...|.|..|    |.::.||    ....||.|.|..||
Zfish     2 SGNPLQPIPGHQVIHVAKDL---DTDLEALFNSVMNPKPSSWRNKDMPQSFFQEPDSGSHSRQSS 63

  Fly   124 TSTITSASTTTTTSRQSQSTPAAVVVPVSSPYLTQSVPQLDIAGAEHSSGDSEPCTPTLAPVHSL 188
            ..   |.|.......:|:|:||::.:|..|           ::|            |:...:||.
Zfish    64 AD---SGSLPPRVHFRSRSSPASLQLPAGS-----------VSG------------PSPGRLHSH 102

  Fly   189 DANSLIALYEQCRAADSYDRICHAIGVVF--SSVDRL------GKSFIRSAEPAASSSLQELLAN 245
            ..:....:.|:......::......|..:  :.::::      .||...|   .|..||...::|
Zfish   103 TRHQSCDVAEELPLPPGWEMAFTPNGQKYFLNHIEKITTWHDPRKSMTPS---VAQLSLHNQVSN 164

  Fly   246 SPG------ALNKEQLRTLEGEHDKDEDSTQQVDEQSESAANATATAESVESEAEPEEEDDDVCS 304
            :..      ||::..|...:..|.:.:...||..:|........|          |::       
Zfish   165 TASIQQRSMALSQPNLVLNQQAHQQQQQHLQQQQQQVPVQVPVQA----------PQQ------- 212

  Fly   305 SQSSDTLVDLPGLRRVQRL 323
             |||..:::|...:..|::
Zfish   213 -QSSQPMMNLSAQQHQQKM 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 6/26 (23%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
wwtr1NP_001032785.1 WW 115..146 CDD:197736 1/30 (3%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.