DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and wwc3

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001103940.1 Gene:wwc3 / 566492 ZFINID:ZDB-GENE-070209-229 Length:1148 Species:Danio rerio


Alignment Length:553 Identity:104/553 - (18%)
Similarity:178/553 - (32%) Gaps:159/553 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EVAARALQLFSQDAQLCEAFTSEANSPQDVDMLSPNDSSSSSSGSSTSTITSASTTTTTSRQSQS 142
            ::..:.|:|..|:.||....|.:.|.     .::.:.|.|||:.........|.......|.|:.
Zfish   124 QIKQQRLELAQQEMQLFNQLTQDDNR-----SITSSHSGSSSNAKYDPDQIKAEIACRRERLSRL 183

  Fly   143 TPAAVVVPVSSPYLTQSVPQLDIAGAEHSSGDSEPCTPTLAPVHSLDANSLIALYEQCRAADSYD 207
            ......:.....|....|..|.....:.||..:.         :.||...  |::.:.|:     
Zfish   184 KQELAQMRQELQYKEMGVETLQEIDRKMSSSQTN---------YKLDEAQ--AIFSELRS----- 232

  Fly   208 RICHAIGVVFSSVDRLGKSFIRSAEPAASSSLQELLANSPGALNKEQLRTLEGEHDKDEDSTQQV 272
                                |:.|........|:|:.    :|.|..|...        ||..:|
Zfish   233 --------------------IKKAISTGEKERQDLIQ----SLAKLTLNFC--------DSINEV 265

  Fly   273 DEQSESAANATATAESVESEAEPEEEDDDVCSSQSSDTLVDLPGLRRVQRLLFGCQIRAITEKLT 337
            ...:||.|::.:..:..::..:.:...:  ..||.|..|.|        |:....|.....:|::
Zfish   266 TNNAESLADSCSVQQYTDAGCQTDLMGE--FGSQESSLLAD--------RVKLSWQYEEAKKKMS 320

  Fly   338 SSVIQLS-----DWV--IYMRTDWERVIHCLVICFDLATNTNNSVVDMDYLDRVLPKLCQAASAM 395
            |...||:     .|.  .....||:        |..|.......:.::..|.:.     |.:|..
Zfish   321 SIQHQLAQLDSESWSGRAEADRDWD--------CLQLLREKETLLQELTLLSQQ-----QHSSDT 372

  Fly   396 PVPAQARLARIWAAHCSDQLHSLIAACQQQITLQVLLDEES---MRENESIISVT----KVLKIV 453
            .:..|....|:     .|::....:|..|....::||.|:.   ||:.|....:|    ..||.:
Zfish   373 LLQLQEEKRRL-----QDEVQRAHSAQSQGANQRILLQEKRNVLMRQLEEATRITTYLHSQLKSL 432

  Fly   454 FYANI-LASELERPSCR-----------------------VPLEDRTEAATASGSAAVEDDLFVY 494
            ..:|: ::|...|.|..                       :|..||||     ||:.|.|..|.|
Zfish   433 SASNLTVSSSSSRGSLASSRGSLASSRGSLSSVSFTDIYGLPQYDRTE-----GSSDVLDPSFRY 492

  Fly   495 NSLLEPHM------PKFAED------QFEKELQVSAI----------------DCRKPLIPLEEF 531
            ...||.|.      ||.:.|      .......:|::                ||  ||..:.|.
Zfish   493 LLPLESHSSGSAYGPKRSHDTPQSLTSLSSRSSLSSLSPPSSPMDTPYHSAPQDC--PLAQMTEE 555

  Fly   532 YNEA-----LSENIQMHHDYLSYKTLAMESEIG 559
            |.|.     |:|.::.......:.||:.:.|:|
Zfish   556 YMEVASRGLLAEGLRTQSQAQQHTTLSGDGEVG 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 4/15 (27%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
wwc3NP_001103940.1 WW 17..46 CDD:278809
WW 64..93 CDD:278809
C2_Kibra 677..800 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.