DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and magi2a

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001314782.1 Gene:magi2a / 564112 ZFINID:ZDB-GENE-050810-4 Length:1503 Species:Danio rerio


Alignment Length:359 Identity:74/359 - (20%)
Similarity:120/359 - (33%) Gaps:94/359 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AVGGRATPEMKRSAVRSLIK--------RYFHQLQSGCGNANCSNANCASSGKVAPMT------- 75
            ||..::...|..:.:..|||        |...|.::.      |..:..||.|.:||.       
Zfish   977 AVNNQSIVNMPHADIVKLIKDAGLSVTLRIIPQEETN------STPSAGSSEKQSPMAQPSPVCQ 1035

  Fly    76 PNEV-AARALQLFSQDAQLCEAFTSEANSP----QDVDMLSPNDSSSSSSGSSTSTITSASTTT- 134
            ||.| ...|..|.:.:||     .:.|..|    |.:....|:..:.:|..:..|::|..:..| 
Zfish  1036 PNTVNQTGAAPLANSNAQ-----QNSAPQPSPIKQPISEAQPSLVTQNSPANHPSSVTQQNPQTQ 1095

  Fly   135 -------TTSRQSQSTPAAVVVP-VSSPYLTQSVPQLDIAGAEHSSGDSEPCT----PTLAPVHS 187
                   .:|.:|:......|.| :..|:.....|.:|......:.....|..    |.|.....
Zfish  1096 PVQTYSHDSSYRSEVKARQDVKPDIRQPFTDYRQPPVDYRHPPVADYRQPPTLDYRHPPLLDYRP 1160

  Fly   188 LDANSLIALYEQCRAADSYDRICHAI-----GVVFSSVDRLGKSF------IRSAE--PAASSSL 239
            |.|:.........|....:|.....:     |..||.  |.|:.:      :|.||  ||..:..
Zfish  1161 LPADPRTFPLPDYRMPQDFDFFTVELEKGMKGFGFSI--RGGREYKMDLFVLRLAEDGPAIRNGR 1223

  Fly   240 QELLANSPGALNKEQLRTLEGEHDKD---------------------EDSTQQVDEQSESAA--N 281
            ..:         .:|:..:.||..:|                     :..|.||.|.::|.|  :
Zfish  1224 MRV---------GDQIIEINGESTRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYADSPAPWD 1279

  Fly   282 ATATAESVESEAEPEEEDDDVCSSQSSDTLVDLP 315
            |..||....||..|..   |..|:.|:.:.|:.|
Zfish  1280 AHPTASPSLSEVAPPL---DSLSNPSASSHVNPP 1310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 18/69 (26%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
magi2aNP_001314782.1 PDZ_signaling 25..100 CDD:238492
NK 122..286 CDD:302627
WW 307..337 CDD:238122
WW 352..381 CDD:278809
PDZ 431..511 CDD:214570
PDZ 595..676 CDD:214570
PDZ 762..856 CDD:214570
PDZ_signaling 920..1007 CDD:238492 7/29 (24%)
PDZ_signaling 1182..1262 CDD:238492 14/90 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.