DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and WWC3

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_056506.2 Gene:WWC3 / 55841 HGNCID:29237 Length:1092 Species:Homo sapiens


Alignment Length:493 Identity:98/493 - (19%)
Similarity:170/493 - (34%) Gaps:134/493 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SSGSSTSTITSASTTTTTSRQSQSTPAAVVVPVSSPYLTQSVPQLDIAGAEHSS----------- 172
            |||||..::.|:..:..:||.|.|:     |..:..|   .:||.:...||.|.           
Human   364 SSGSSRGSLASSRGSLASSRGSLSS-----VSFTDIY---GLPQYEKPDAEGSQLLRFDLIPFDS 420

  Fly   173 -GDSEPCTPTLAPV------HSLDANSLIALYEQCRAADSYDRICHAIGVVF--SSVDRLGKSFI 228
             |...|.:....|.      .|||....:|......:..|.......:...|  :|.|.......
Human   421 LGRDAPFSEPPGPSGFHKQRRSLDTPQSLASLSSRSSLSSLSPPSSPLDTPFLPASRDSPLAQLA 485

  Fly   229 RSAEPAASSSLQELLANSPGALNKEQLRTL------------EGEHDKD---------------E 266
            .|.|.....:|..|.|:: .|:..|.|..:            ||.|::.               |
Human   486 DSCEGPGLGALDRLRAHA-SAMGDEDLPGMAALQPHGVPGDGEGPHERGPPPASAPVGGTVTLRE 549

  Fly   267 DSTQQVDEQSE---------SAANATATAESVESEAEPEEEDDDVCSSQSSDTLVDLPGLRRVQR 322
            ||.::::.::.         |.|:.:...|.:....|..||.....::.:.|..:.: ||.|   
Human   550 DSAKRLERRARRISACLSDYSLASDSGVFEPLTKRNEDAEEPAYGDTASNGDPQIHV-GLLR--- 610

  Fly   323 LLFGCQIRAITEKLTSSVIQLSDWV-IYMRTDWERVIHCLVICFDLATNTNNSVVDMDYLDRVL- 385
                   .:.:|.|...|:||.:.. :.::.|.:  :|..|....|.:.|.|:     |..:.| 
Human   611 -------DSGSECLLVHVLQLKNPAGLAVKEDCK--VHIRVYLPPLDSGTPNT-----YCSKALE 661

  Fly   386 ---PKLCQAASAMPVPAQA---RLARIWAAHCSDQL-HSLIAACQQQI--------------TLQ 429
               |.:......:||.:.|   :..:::....:.|| ..|:...|..:              ::|
Human   662 FQVPLVFNEVFRIPVHSSALTLKSLQLYVCSVTPQLQEELLGIAQINLADYDSLSEMQLRWHSVQ 726

  Fly   430 VLLDEESMRENESIISVTKVLKIVFYANILASELERPSCRVPLEDRTEAAT---ASGSA---AVE 488
            |....|..|..|:..:.             .|....|:..:.:..:|:|.|   |..:|   |||
Human   727 VFTSSEPSRTREAGCAG-------------ESSARDPAHTISISGKTDAVTVLLARTTAQLQAVE 778

  Fly   489 DDLFVYNSLLEPHMPKFAEDQF----EKELQVSAIDCR 522
            .:|....:.||     :.|::.    .||.|..||..|
Human   779 RELAEERAKLE-----YTEEEVLEMERKEEQAEAISER 811

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
WWC3NP_056506.2 THOC7 <4..119 CDD:283305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..384 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..488 11/65 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..544 4/33 (12%)
C2_Kibra 602..725 CDD:176062 24/140 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.