DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and bag3

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001003533.1 Gene:bag3 / 445139 ZFINID:ZDB-GENE-040801-40 Length:459 Species:Danio rerio


Alignment Length:365 Identity:80/365 - (21%)
Similarity:118/365 - (32%) Gaps:128/365 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SSG-KVAPMTPNEVAARALQLFSQDAQLCEAFTSEANSPQ------DVDMLSPNDSSSSSSGSST 124
            |:| .::|.||.:              :.:.|.:|...|.      .:.:...|.........|.
Zfish    46 SNGPSMSPETPQD--------------MHKTFINEMRQPMLRQGYIPIPVCHENPEPRLQQYPSF 96

  Fly   125 STITSA--STTTTTSRQSQSTPAAVVVPVSSPYLTQSVPQLDIAGAEHSSGDSEPCTPTLAPVHS 187
            |.|..|  ....|..|....||||...| .||..|.|         |..|.    |:||   .|.
Zfish    97 SYIHPAVQQNLRTDGRTPSPTPAAHCRP-RSPVQTPS---------EACSS----CSPT---SHG 144

  Fly   188 LDA-------NSLIALYEQCRAADSYDR-------ICH--AIGVVFSSVDRLG----KSFIRSAE 232
            .:.       ..:..|::|.|::::..|       :.|  |.||:.|.:.:..    :...|...
Zfish   145 PEGYQPQGTHQQISGLHQQPRSSNTGLRAGYIPIPVIHEGAGGVLPSQLSQSSHPTREKIYREQV 209

  Fly   233 P-------AASSSLQELLANSPGAL----NKEQLRTLEG--------EHDKDE------------ 266
            |       |||.....|.|.||...    .:.|::...|        ||..:|            
Zfish   210 PIQIQQNRAASPIQVPLRAQSPVMAQIMGERPQMQQHIGHTAIPSKIEHPVEEIIRVPTFEVPIQ 274

  Fly   267 ------------------DSTQQVDEQSESAANATATAE---SVESEAEPEE-----EDDDVCSS 305
                              ..|||...:::.:...:.|:.   .|....||:|     ...:|.||
Zfish   275 RVSEVPQQIHHQPVQQQQQPTQQPQPKAQPSPQVSETSNITIQVPPAPEPQETAAPQTPQEVPSS 339

  Fly   306 --QSSDTL-VDL--PGLRRVQRLLFGCQIRAITEKLTSSV 340
              |..:|| .||  |||.:||      ||....|||..:|
Zfish   340 QLQPEETLEQDLSHPGLVKVQ------QIVERVEKLAQNV 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 5/27 (19%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
bag3NP_001003533.1 WW 6..38 CDD:197736
BAG 358..432 CDD:214591 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.