DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and kibra

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster


Alignment Length:519 Identity:91/519 - (17%)
Similarity:146/519 - (28%) Gaps:243/519 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SGKVAPMTPNEVAARALQLFSQDAQLCEAFTSEANSPQDVDMLSPNDSSSSSSGSSTSTITSAST 132
            |.|..|      :..:|.:.|..|....|..:.:|        :||..::....|..|||||:.|
  Fly   815 SSKFIP------SFESLDIPSTSAAAAAAAVAASN--------APNPGNNREESSDESTITSSQT 865

  Fly   133 TTTTSRQSQSTPAAVVVPVSSPYLTQSVPQLDIAGAEHSSGDSEPCTPTLAPVHSLDANSLIALY 197
            :|.|..|:                                    ||               :.|.
  Fly   866 STLTRNQA------------------------------------PC---------------MELQ 879

  Fly   198 EQCRAADSYDRICHAIGVVFSSVDRLGKSFIRSAEPAASSSLQELLANSPGALNKEQLRTLEGEH 262
            ||..|                                      |||...|  ||:.     |...
  Fly   880 EQMAA--------------------------------------ELLGLGP--LNEP-----ECSD 899

  Fly   263 DKDEDSTQQVDEQS--------ESAANATATAESVESEAEPEEEDDDVC----SSQSSDTLVDLP 315
            |.|:|..:::|::.        .|::...|..::::.|...:|.:.|..    .|:....|:|..
  Fly   900 DDDDDEEEELDDKQLVSDVGLMNSSSMLHAYLQNMKQEFADKETNTDRAYLPEKSRGQSQLMDDR 964

  Fly   316 GLRRVQRLL---------FGCQIRAITEKLTSSVIQLSDWVIYMRTDWERVIHC----------- 360
            .::|.|...         :.|::.                    |:|.:..:||           
  Fly   965 PVKRSQTFTPSEAFSKNRYNCRLN--------------------RSDSDSAMHCGVAPHTFQRGA 1009

  Fly   361 ----------------------------LVICFDLATN------TNNSVVDMDYLDRVLPKLCQA 391
                                        |.:..||...      .|:.:..:..|..||.|.|:.
  Fly  1010 AERRSLRFHSKAPKSVTKLHHTHIPRTSLDLELDLQAQHSKLYFLNDQIAKLQNLKEVLQKACEN 1074

  Fly   392 ASAMPVPAQARLARIWAAHCSDQLHSLI-----AACQQQITLQVLLDEESMRENESI--ISVTKV 449
            ...        |...||.. :::...|:     |.|.::..||.||    |:..:.|  :..|||
  Fly  1075 KDP--------LVAAWAIE-NEEFQRLVARADPAKCPEERQLQKLL----MKTAKEIHKLRKTKV 1126

  Fly   450 -----------LKIVFYAN------ILASELERPSCRVPLEDRTEAATASGSAAVEDDLFVYNS 496
                       .||.|:..      .|.||...|... |:|:..|.         ||:...|||
  Fly  1127 PKGCPDLVSFKEKITFFTRKGLSVPELPSEFTLPEAN-PIEEEEEE---------EDENEFYNS 1180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 6/25 (24%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:278809
C2_Kibra 693..813 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.