DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and yki

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster


Alignment Length:455 Identity:101/455 - (22%)
Similarity:153/455 - (33%) Gaps:152/455 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DVDMLSPNDSSSSSSGSSTSTITSASTTTTTSRQ----SQSTPAAVVVPVSSPYLTQSVPQLDIA 166
            |.|||||.        .|.:.:...:..|..:.|    |...|.....|:..|...:.:|     
  Fly    44 DEDMLSPI--------KSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLP----- 95

  Fly   167 GAEHSSGDSEPCTPTLAPVHSLDANSLIALYEQCRAADSYDRICHAIGVVFSSVDRL-GKSFIRS 230
                    :...||. ||.|| .|||..:.|:    |.|...|  .||...|.|.:. |:|.|  
  Fly    96 --------NSFFTPP-APSHS-RANSADSTYD----AGSQSSI--NIGNKASIVQQPDGQSPI-- 142

  Fly   231 AEPAASSSLQELLANSPGALNKEQLRTLEGEHDKDEDSTQQVDE------QSESAA--NATATAE 287
               ||...||  :..||      |...|...|.:...|...:.:      :|::||  |..|...
  Fly   143 ---AAIPQLQ--IQPSP------QHSRLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPS 196

  Fly   288 SVESEAE---PEEEDDDVCSSQSSDTLVDLPGLRRVQRLLFGCQIRAITEKLTS----SVIQLSD 345
            |.:..|.   ||....:..|...:.:.:||..:...........::.:.:|..|    |.|||:.
  Fly   197 SQQQPAGPTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNR 261

  Fly   346 WVIYMRTDWERVIHCLVICFDLATNTNNSVVDMDYLDRVL-------PKLCQAASAMPVPAQARL 403
            .:..:...||:            ..||:.  .:.||:...       |::           |.| 
  Fly   262 QLGALPPGWEQ------------AKTNDG--QIYYLNHTTKSTQWEDPRI-----------QYR- 300

  Fly   404 ARIWAAHCSDQLHSLIAACQQQITLQVLLDEESMRENESIISVTKVLKIVFYANILASELERPSC 468
                               |||   |:|: .|.:::|: ::..||.......||.|.        
  Fly   301 -------------------QQQ---QILM-AERIKQND-VLQTTKQTTTSTIANNLG-------- 333

  Fly   469 RVPLEDRTE-AATASGSAAVEDDLFVYN------SLLEPHMPKFAEDQFEKELQVSAIDCRKPLI 526
              ||.|..| |.|.||      ||:..|      |..:|.|          :..:|.:||...|:
  Fly   334 --PLPDGWEQAVTESG------DLYFINHIDRTTSWNDPRM----------QSGLSVLDCPDNLV 380

  Fly   527  526
              Fly   381  380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 39/196 (20%)
WW 266..295 CDD:395320 6/42 (14%)
WW 335..364 CDD:395320 11/34 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.