DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and Smurf2

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001100531.1 Gene:Smurf2 / 303614 RGDID:1310067 Length:748 Species:Rattus norvegicus


Alignment Length:522 Identity:142/522 - (27%)
Similarity:245/522 - (46%) Gaps:100/522 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   541 QMHHDYLSYKTLAMESEIGSGHANYFSFMLYAFILTPSTKVDALYYDSRM--------------- 590
            |.|.:|:|...|....::..|:....:.....:.|...|.| :.::|.|:               
  Rat   236 QRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGV-STWHDPRVPRDLSNINCEELGPL 299

  Fly   591 ------------RMY------------SERYS-SLHSILNNIGQVGQEDNPR-----PD------ 619
                        |:|            ..|.| :||.:||...|:..:...:     ||      
  Rat   300 PPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDTECLT 364

  Fly   620 ----------------------------LKLTVRRDQLINDALIGLEMVAMSNPKDLKKQLVVEF 656
                                        .::.|.|:::..::   ...|....||||.|:|:::|
  Rat   365 VPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEES---YRQVMKMRPKDLWKRLMIKF 426

  Fly   657 VGEQGIDEGGVSKEFFQLIVEEIFNPAFGMF-IQQEETNNMWFN---ATPFENGAQFTLIGIIIG 717
            .||:|:|.|||::|:..|:..|:.||.:|:| ..:::...:..|   |...|:.:.|..:|.|:|
  Rat   427 RGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMG 491

  Fly   718 LAIYNNVTLAVNFPMVVYRKLIGYCGTFADLSDWSPALYKSLKSMLDYQGQDMEEVFEQTFKISY 782
            :|:::...:...|.:..|::|:|...|..|:....|.|:.||..:|:   .|:..|.:.||.:.:
  Rat   492 MAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILE---NDITGVLDHTFCVEH 553

  Fly   783 SDVFGDVVQHELVPNGQDVLVGQHNKELFVNLYSDFLLNTNIEQQFNAFRKGFEMVTDESPLKLL 847
             :.:|:::||||.|||:.:.|.:.||:.:|.||.::.....||.||.|.:|||..|..:..|| .
  Rat   554 -NAYGEIIQHELKPNGKSIPVTEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLK-T 616

  Fly   848 FRPEEIEMLVCGSREFDFVELENSTVYEGGYTEKSQYIQDFWSIVHAMPSEDKHKLLEFTTGSAR 912
            |..:|:|:::||..:.|..:.:.:|..: ..|..|..::.||..|.....|.:.:||:|.|||:|
  Rat   617 FDEKELELIICGLGKIDVSDWKANTRLK-HCTPDSNVVKWFWKAVELFDEERRARLLQFVTGSSR 680

  Fly   913 VPVGGLKCLR-----LLITRHGPD--SDRLPTSHTCFNVLLLPEYSSREKLEERLMKAINYSKGF 970
            ||:.|.|.|:     .|.|.|..|  ::.||.:|||||.:.:|.|.|.|||.|:|:.||..:.||
  Rat   681 VPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGF 745

  Fly   971 GM 972
            .:
  Rat   746 AV 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166
HECTc 620..971 CDD:238033 119/361 (33%)
HECTc 647..970 CDD:214523 113/333 (34%)
Smurf2NP_001100531.1 C2_Smurf-like 13..137 CDD:176028
PRP40 155..>236 CDD:227435 142/522 (27%)
WW 159..188 CDD:395320
WW 252..283 CDD:197736 5/31 (16%)
WW 298..330 CDD:197736 2/31 (6%)
HECTc 393..745 CDD:238033 118/360 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.