DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and Wwc1

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_002727807.1 Gene:Wwc1 / 303039 RGDID:1308329 Length:1108 Species:Rattus norvegicus


Alignment Length:307 Identity:64/307 - (20%)
Similarity:112/307 - (36%) Gaps:77/307 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LQSGCGNANCSNANCASSGKVAPMTPNEVAARALQLFSQDAQLCEAFTSEANSPQDVDMLSPNDS 115
            |:..|.:|..|:.:.|....|       ..|...:|.:.:|...::..|||.....|.:....|.
  Rat   614 LKVACVSAAVSDESVAGDSGV-------YEASMQRLGTSEAAAFDSDESEAVGVTQVQIALKYDE 671

  Fly   116 SSSSSG------SSTSTI-----------------TSASTTTTTSRQSQSTPAAVV-----VPVS 152
            .|....      |:.|.:                 :.:||....:|...|..:.|.     |.:|
  Rat   672 KSKQFAILVIQLSNLSALLLQQDQKVNIRVAILPCSESSTCLFRTRPLDSADSLVFNEAFWVSMS 736

  Fly   153 SPYLTQSVPQLDIAGAEHSSGDSEPCTPTLAPVHSLDANSLIALYEQCRAADSYDRICHAIGVVF 217
            .|.|.|...::|:...:.|  .:|.|.          ..:.|:|.|.||:.:...|..:.:.  :
  Rat   737 YPALHQKTLRVDVCTTDRS--HTEECL----------GGAQISLAEVCRSGERSTRWYNLLS--Y 787

  Fly   218 SSVDRLGKSFIRSAEPAAS------SSLQELLANSPGALNKEQ-----LRTLEGEHDKDEDSTQQ 271
            ..:.:.|    |..:||.:      .::..||..:...|.|.|     .:||||....:|::::.
  Rat   788 KYLKKQG----REPQPAEAPGPDHVDAVSALLEQTAVELEKRQEGRSSSQTLEGSWTYEEEASEN 848

  Fly   272 VDEQSESAANATATAESVESEAEPEEEDDDVCSSQSSDTLVDLPGLR 318
                       .|.||  |.|.|.||.::||.:.:.|....:.|.|:
  Rat   849 -----------EAVAE--EEEREEEEGEEDVFAEKVSPEAEECPALK 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 9/42 (21%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
Wwc1XP_002727807.1 WW 9..39 CDD:238122
WW 55..84 CDD:278809
ALDH-SF 378..>420 CDD:299846
C2_Kibra 661..784 CDD:176062 25/134 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.