DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and Wwtr1

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001020040.1 Gene:Wwtr1 / 295062 RGDID:1559609 Length:395 Species:Rattus norvegicus


Alignment Length:162 Identity:39/162 - (24%)
Similarity:55/162 - (33%) Gaps:50/162 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 MTPNEVAARALQLFSQDAQLCEAFTSE------ANSP-QDVDMLSPNDSSSS---------SSGS 122
            |....:..|..:|..|:|.||.....|      .|:| .:.||.|..:|||.         |...
  Rat   241 MERERIRMRQEELMRQEAALCRQLPMETETMAPVNTPAMNTDMRSVTNSSSDPFLNGGPYHSREQ 305

  Fly   123 STST---ITSASTTTT------------TSRQSQSTPAAVVVPVSSPYLTQSVPQLDIAGAEHSS 172
            ||.:   :...|..||            |...|..||..|     :|..|:....||        
  Rat   306 STDSGLGLGCYSVPTTPEDFLSNMDEMDTGENSGQTPMTV-----NPQQTRFPDFLD-------- 357

  Fly   173 GDSEPCTP-TLAPVHSLDANSLIALYEQCRAA 203
                 |.| |...:.:|::..||.|:....:|
  Rat   358 -----CLPGTNVDLGTLESEDLIPLFNDVESA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 5/19 (26%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
Wwtr1NP_001020040.1 WW 125..156 CDD:197736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.