DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and Bag3

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001011936.1 Gene:Bag3 / 293524 RGDID:1307794 Length:574 Species:Rattus norvegicus


Alignment Length:441 Identity:84/441 - (19%)
Similarity:129/441 - (29%) Gaps:188/441 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GEDDQHLPGVSSASGSAAGAVGGRATPEMKRSAVRS--LIKRY-------------------FHQ 50
            |.:....|..|..|.|::.|    :.|...||::.|  |.:.|                   |||
  Rat   170 GPERSQSPAASDCSSSSSSA----SLPSSGRSSLGSHQLPRGYIPIPVIHEQNITRPAAQPSFHQ 230

  Fly    51 LQSGCGNANCSNANCASSGKVAPMTP-------NEVAARALQLFSQDAQLCEAFTSEANSPQDVD 108
            .|        .....|..|:..|..|       ::...|.|:.           ||...||  |.
  Rat   231 AQ--------KTHYPAQQGEYQPQQPVYHKIQGDDWEPRPLRA-----------TSPFRSP--VR 274

  Fly   109 MLSPNDSSSSSSGSSTSTITSASTTTTTSRQSQST---PAAVVVPVSSPYLTQSVPQLDIAGAEH 170
            ..|..:.|.:.||:.....:.....|...|....|   |..|..|.:.|   :|.|.|  ||.:.
  Rat   275 GASSREGSPARSGTPVHCPSPIRVHTVVDRPQPMTHREPPPVTQPENKP---ESKPGL--AGPDL 334

  Fly   171 SSG-----------DSEP---------------------------------------------CT 179
            ..|           ||:|                                             ..
  Rat   335 PPGHIPIQVIRREADSKPVSQKPPPPAEKVEVKVSSAPIPCPSPGPAPSAVPSSPKNVAAEPKAA 399

  Fly   180 PTLAPVHSLDANS--------------LIALYEQC----RAADSYDRICHAIG------------ 214
            |:.||..:....|              :.|:.|:.    :|.|:::      |            
  Rat   400 PSPAPAEAASLKSGDAEAPHKHPGVLKVEAILEKVQGLEQAVDNFE------GKKTDKKYLMIEE 458

  Fly   215 ------VVFSSVDRLGKSFIRSAEPAASSSLQELL-------ANSPGALNKEQLR--TLEGEH-- 262
                  :...|||..|::.:|.|.......:|.:|       .:.||.:...:|:  .||.|.  
  Rat   459 YLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEPEQPL 523

  Fly   263 ---------DKDEDSTQQVDEQSES------AA---NATATAESVESEAEP 295
                     |||:...:..|.|:||      ||   |.::||:|..:...|
  Rat   524 QEIMGAVAADKDKKGPENEDPQTESQQLEAKAATPPNPSSTADSAGNPVAP 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 13/81 (16%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
Bag3NP_001011936.1 WW 23..55 CDD:197736
BAG 423..500 CDD:214591 13/82 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.