DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and Wwp2

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001099654.1 Gene:Wwp2 / 291999 RGDID:1310091 Length:870 Species:Rattus norvegicus


Alignment Length:368 Identity:120/368 - (32%)
Similarity:199/368 - (54%) Gaps:30/368 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 LKLTVRRDQLINDALIGLEMVAMSNPKDLKKQLVVEFVGEQGIDEGGVSKEFFQLIVEEIFNPAF 684
            :|::|.|..|..|:   .:.:....|.||:::|.:...||:|:|.||:::|:|.|:..|:.||.:
  Rat   515 VKISVSRQTLFEDS---FQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMY 576

  Fly   685 GMFIQQEETNNMWFNATPF-----ENGAQFTLIGIIIGLAIYNNVTLAVNFPMVVYRKLIGYCGT 744
            .:| :....||......|.     ::...|..||..|.:|:|:...:...|.:..|::::....|
  Rat   577 CLF-EYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPT 640

  Fly   745 FADLSDWSPALYKSLKSMLDYQGQDMEEVFEQTFKISYSDVFGDVVQHELVPNGQDVLVGQHNKE 809
            ..||....|..|.|:   :..:..:::|...:.|.|...::.|.|..|||...|:::.|.:.|||
  Rat   641 LRDLESIDPEFYNSI---IWIKENNLDECGLELFFIQDMEILGKVTTHELKEGGENIRVTEENKE 702

  Fly   810 LFVNLYSDFLLNTNIEQQFNAFRKGFEMVTDESPLKLL--FRPEEIEMLVCGSREFDFVELENST 872
            .::.|.:|:.....:|:|..||..||..|   :||:.|  |..:|:|:::||.:|.|..:.:.:.
  Rat   703 EYIMLLTDWRFTRGVEEQTKAFLDGFNEV---APLEWLRYFDEKELELMLCGMQEIDMSDWQKNA 764

  Fly   873 VYEGGYTEKSQYIQDFWSIVHAMPSEDKHKLLEFTTGSARVPVGGLKCLRLLITRHGPDS---DR 934
            :|. .||:.|:.||.||.:|..|.:|.:.:||:|.||:.|:||||   ...||..:||..   ||
  Rat   765 IYR-HYTKSSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGG---FAELIGSNGPQKFCIDR 825

  Fly   935 ------LPTSHTCFNVLLLPEYSSREKLEERLMKAINYSKGFG 971
                  ||.||||||.|.||.|.|.|:|:|:|:.||..::|||
  Rat   826 VGKETWLPRSHTCFNRLDLPPYKSYEQLKEKLLYAIEETEGFG 868

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166
HECTc 620..971 CDD:238033 118/366 (32%)
HECTc 647..970 CDD:214523 111/338 (33%)
Wwp2NP_001099654.1 C2_E3_ubiquitin_ligase 17..142 CDD:175988
WW 302..331 CDD:278809
WW 332..361 CDD:278809
WW 407..435 CDD:278809
WW 447..477 CDD:238122
HECTc 516..868 CDD:238033 118/365 (32%)
HECTc 539..867 CDD:214523 111/338 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.