DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and WWC1

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_011532787.1 Gene:WWC1 / 23286 HGNCID:29435 Length:1185 Species:Homo sapiens


Alignment Length:580 Identity:112/580 - (19%)
Similarity:191/580 - (32%) Gaps:178/580 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LQSGCGNANCSNANCASSGKVAPMTPNEVAARALQLFSQDAQLCEAFTSEANSPQDVDMLSPNDS 115
            |:..|.:|..|:.:.|....|...:...:.|.....|..|       .|||.....:.:....|.
Human   674 LKVACVSAAVSDESVAGDSGVYEASVQRLGASEAAAFDSD-------ESEAVGATRIQIALKYDE 731

  Fly   116 SSSSSGSSTSTITSASTTTTTSRQSQSTPAAVV----------------------------VPVS 152
            .:.........:::.|.......|..:...||:                            |.:|
Human   732 KNKQFAILIIQLSNLSALLQQQDQKVNIRVAVLPCSESTTCLFRTRPLDASDTLVFNEVFWVSMS 796

  Fly   153 SPYLTQSVPQLDIAGAEHSSGDSEPCTPTLAPVHSLDANSLIALYEQCRAAD---------SY-- 206
            .|.|.|...::|:            ||...:.:......:.|:|.|.||:.:         ||  
Human   797 YPALHQKTLRVDV------------CTTDRSHLEECLGGAQISLAEVCRSGERSTRWYNLLSYKY 849

  Fly   207 ----DRICHAIGVVFSSVDRLGKSFIRSAEPAASSS-----LQELLANSPGALNKEQLRTLEGEH 262
                .|....:||:           ..::.||::.|     :..||..:...|.|.|    ||  
Human   850 LKKQSRELKPVGVM-----------APASGPASTVSWDQDAVSALLEQTAVELEKRQ----EG-- 897

  Fly   263 DKDEDSTQQVDE--QSESAANATATAESVESEAEPEEEDDDVCSSQSSDTLVDLPGL-------- 317
               ..|||.:::  :.|..:...|.||..|.|.|.||.::||.:.::|..:...|.|        
Human   898 ---RSSTQTLEDSWRYEETSENEAVAEEEEEEVEEEEGEEDVFTEKASPDMDGYPALKVDKETNT 959

  Fly   318 --------------RRVQRLLFGCQIR--AITEKLTSSVIQLSDWVIYM-RTDWERVIHCLVICF 365
                          |||.....|..:|  .|....|.|....|.:|..: |:|           .
Human   960 ETPAPSPTVVRPKDRRVGTPSQGPFLRGSTIIRSKTFSPGPQSQYVCRLNRSD-----------S 1013

  Fly   366 DLATNTNNSVVDMDYLDRVLPKLCQAASAMPVPAQARLARIWAAHCSDQLHSLIAACQQQITLQV 430
            |.:|.:.......:.|:|...:: :..|..|.|:..:..|      |::|  :..:...::.||.
Human  1014 DSSTLSKKPPFVRNSLERRSVRM-KRPSPPPQPSSVKSLR------SERL--IRTSLDLELDLQA 1069

  Fly   431 LLDEESMRENESIISVTKVLKIVFYANILASELERPSCRVPLEDRTEAATASGSAAV-----EDD 490
            .....|....|  |||.|.||                      ::.|.|.:.|...:     ||:
Human  1070 TRTWHSQLTQE--ISVLKELK----------------------EQLEQAKSHGEKELPQWLREDE 1110

  Fly   491 LF-VYNSLLEPHMPKFAED----QFEKELQVSAID--------CRKPLIPLEEFYNEALS 537
            .| :...:||......||.    |.:|.::.:|.|        |::|  |..:.:.|.::
Human  1111 RFRLLLRMLEKRQMDRAEHKGELQTDKMMRAAAKDVHRLRGQSCKEP--PEVQSFREKMA 1168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 9/42 (21%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
WWC1XP_011532787.1 WW 9..39 CDD:238122
WW 55..84 CDD:278809
ALDH-SF 429..>481 CDD:299846
C2_Kibra 721..844 CDD:176062 18/134 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.