DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and Gas7

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_006532265.1 Gene:Gas7 / 14457 MGIID:1202388 Length:476 Species:Mus musculus


Alignment Length:355 Identity:67/355 - (18%)
Similarity:109/355 - (30%) Gaps:134/355 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 WAAHCSDQLHSLIAACQQQITLQVLLDEESM------RENESII------SVTKVLKIVFYANIL 459
            |.....|.|.....|...|     ||::..|      .|::::|      |........:|.|..
Mouse    40 WEGEKDDGLRGWFPASYVQ-----LLEKPGMVPPPPGEESQTVILPPGWHSYLSPQGRRYYVNTT 99

  Fly   460 ASEL--ERPSC-----------RVPLEDRTEAATASGSAA------------------------- 486
            .:|.  ||||.           |..|........|||:.|                         
Mouse   100 TNETTWERPSSSPGISASPGPHRSSLPTTVNGYHASGTPAHPPETAHMSLRKSTGDSQNLGSSSP 164

  Fly   487 ----VEDDLFVYNSLLEPHMPKFAEDQFEKELQVSAID---------------------CRKPL- 525
                .:::....|.:..||.....|.|..|..:.|..|                     .:|.| 
Mouse   165 GRKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLK 229

  Fly   526 -IPLEEFYNEALSENIQMHHDY------LSYKTLAMESE--IGSGHANY-------------FSF 568
             ..:::..:|.:.|.|::..:|      ||..:||.:.|  :|...|..             ||.
Mouse   230 GKQMQKEMSEFIRERIKIEEEYAKNLAKLSQNSLAAQEEGSLGEAWAQVKKSLADEAEVHLKFSA 294

  Fly   569 MLYAFILTP-----------STKVDALYYDSRMRMYSERYSSLHSILNNIGQVGQEDNPRPDLKL 622
            .|::.:..|           ..|.|....|.|.::.| ||:|:......:.: .|:|       |
Mouse   295 KLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLAS-RYASVEKARKALTE-RQKD-------L 350

  Fly   623 TVRRDQLINDALIGLEMVAMSN--PKDLKK 650
            .::..||         .:.:||  .:|:||
Mouse   351 EMKTQQL---------EIKLSNKTEEDIKK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166
HECTc 620..971 CDD:238033 8/33 (24%)
HECTc 647..970 CDD:214523 3/4 (75%)
Gas7XP_006532265.1 SH3_GAS7 5..57 CDD:212763 4/16 (25%)
WW_FCH_linker 109..201 CDD:374680 14/91 (15%)
F-BAR_GAS7 214..446 CDD:153333 35/176 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.