DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ube3a and YAP1

DIOPT Version :9

Sequence 1:NP_648452.1 Gene:Ube3a / 39266 FlyBaseID:FBgn0061469 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_005271435.1 Gene:YAP1 / 10413 HGNCID:16262 Length:510 Species:Homo sapiens


Alignment Length:527 Identity:104/527 - (19%)
Similarity:172/527 - (32%) Gaps:187/527 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GKVAPMTPNEVAARALQLFSQ---------------DAQLCEAFTS-----EANSPQDVDM---- 109
            |:..|..|.:.|..|.|...|               :..|...|.:     .||.||.|.|    
Human    26 GQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRK 90

  Fly   110 -----LSPNDSSSSSSGSSTSTITSASTTTTTSRQSQS--------------TPAAVVV-PVSSP 154
                 ..|.:..|.|..:||...|:.:.|....|...|              ||..||. |.::|
Human    91 LPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATP 155

  Fly   155 ---YLTQS---VPQLDI---AG---AEHSSGD-------------SEP----------CTPTLAP 184
               :|.||   :|. |:   ||   |:.|||.             .:|          ..||..|
Human   156 TAQHLRQSSFEIPD-DVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPP 219

  Fly   185 VHSLDANS----LIALYEQCRAADSYDRICHAIGVVFSSVD-----RLGKSF---------IRSA 231
            |.....||    |...:||....|......:......|.:|     |.||:.         ::..
Human   220 VQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFGKAMNQRISQSAPVKQP 284

  Fly   232 EPAASSSLQELLANSPGALNKEQLRTLEGEHDKD------EDSTQQVDEQ-----SESAANATAT 285
            .|.|..|.|..:.....:..::|:|..:.:.:|:      ::..:||..|     :.|.||:...
Human   285 PPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQVRPQAMRNINPSTANSPKC 349

  Fly   286 AE-SVESEAEPEEEDDDVCSSQSSDTLVDLPGLRRVQRLLFGCQIRAIT---------------- 333
            .| ::.|:....|:|....:..||      ||:.:        ::|.:|                
Human   350 QELALRSQLPTLEQDGGTQNPVSS------PGMSQ--------ELRTMTTNSSDPFLNSGTYHSR 400

  Fly   334 EKLTSSVIQLSDWVIYMRTDWERVIHCLVICFDLATNTNNSVVDMDYLDRVLPKLCQAASAMPVP 398
            ::.|.|.:.:|.:.:....|                :..|||.:||..|.:        :...:|
Human   401 DESTDSGLSMSSYSVPRTPD----------------DFLNSVDEMDTGDTI--------NQSTLP 441

  Fly   399 AQARLARIWAAHCSDQLHSL----------------IAACQQQITLQVLLDEESMRENESIISVT 447
            :|..       ...|.|.::                |...:...:||..|..:.:.:.||:::.|
Human   442 SQQN-------RFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAAT 499

  Fly   448 KVLKIVF 454
            |:.|..|
Human   500 KLDKESF 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ube3aNP_648452.1 AZUL 40..94 CDD:293166 7/39 (18%)
HECTc 620..971 CDD:238033
HECTc 647..970 CDD:214523
YAP1XP_005271435.1 WW 174..203 CDD:238122 6/28 (21%)
WW 232..261 CDD:366073 5/28 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.