DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plod and OGFOD2

DIOPT Version :9

Sequence 1:NP_648451.1 Gene:Plod / 39265 FlyBaseID:FBgn0036147 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001291762.1 Gene:OGFOD2 / 79676 HGNCID:25823 Length:350 Species:Homo sapiens


Alignment Length:220 Identity:45/220 - (20%)
Similarity:78/220 - (35%) Gaps:69/220 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 DDFNTTVTRPDFYTLFSNEIDWTEKYIHPNYSLQ--------LNESNKIQQPCPDVYWFQIVSDA 557
            |........|:|..:       ||..:.|:..|:        ::|..:|       |...:.:..
Human    98 DSLQDAALAPEFLAV-------TEYSVSPDADLKGLLQRLETVSEEKRI-------YRVPVFTAP 148

  Fly   558 FCDDLVAIMEAHNGWSDGSNNDNRLEGGYEAVPTRDIHMKQVGLERLYLKFLQMFVRPLQERAFT 622
            ||..|:..:| |...||...........|      .:.:.::||:       :..:.||:||   
Human   149 FCQALLEELE-HFEQSDMPKGRPNTMNNY------GVLLHELGLD-------EPLMTPLRER--- 196

  Fly   623 GYFHNPPRALM-------------NFMVRYRPDEQPSLRPHHDSSTYTINIAMNRAGIDYQGGGC 674
              |..|..||:             .|:|:|.|.:...|..|:|::..|:|:|:.:.   :.||..
Human   197 --FLQPLMALLYPDCGGGRLDSHRAFVVKYAPGQDLELGCHYDNAELTLNVALGKV---FTGGAL 256

  Fly   675 RFIRYNCSVTDTKKGWMLMHPGRLT 699
            .|            |.:...|..||
Human   257 YF------------GGLFQAPTALT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlodNP_648451.1 Glyco_tranf_GTA_type 303..>395 CDD:325014
P4Hc 555..719 CDD:214780 35/158 (22%)
OGFOD2NP_001291762.1 P4Hc 146..308 CDD:214780 35/158 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1971
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.