DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plod and Ogfod2

DIOPT Version :9

Sequence 1:NP_648451.1 Gene:Plod / 39265 FlyBaseID:FBgn0036147 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_079947.1 Gene:Ogfod2 / 66627 MGIID:1913877 Length:349 Species:Mus musculus


Alignment Length:196 Identity:46/196 - (23%)
Similarity:78/196 - (39%) Gaps:51/196 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   548 VYWFQIVSDAFCDDLVAIMEAHNGWSD---GSNNDNRLEGGYEAVPTRDIHMKQVGLERLYLKFL 609
            :|...:.|..||..|:..:| |...||   |..|.....|         :.|.::||:       
Mouse   138 IYRVPVFSAKFCQTLLEELE-HFEQSDMPKGRPNTMNNHG---------VLMYELGLD------- 185

  Fly   610 QMFVRPLQERAFTGYFHNPPRALM-------------NFMVRYRPDEQPSLRPHHDSSTYTINIA 661
            ...|.||:||     |..|..||:             .|:|:|...:...|..|:|::..|:|:|
Mouse   186 DPLVTPLRER-----FLLPLMALLYPDYGGGYLDSHRAFVVKYALGQDLDLGCHYDNAELTLNVA 245

  Fly   662 MNRAGIDYQGGGCRF---IRYNCSVTDTKK-----GWMLMHPGRLTHYHEGLLVTNGTRYIMISF 718
            :   |.|:.||...|   .:...::.:|.:     |..::|.|...|....|  ..|.|:.::.:
Mouse   246 L---GKDFTGGALYFGGLFQAPAALKETLEVEHVVGSGILHRGGQLHGARPL--CKGERWNLVVW 305

  Fly   719 I 719
            :
Mouse   306 L 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlodNP_648451.1 Glyco_tranf_GTA_type 303..>395 CDD:325014
P4Hc 555..719 CDD:214780 45/187 (24%)
Ogfod2NP_079947.1 P4Hc 145..307 CDD:214780 45/189 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1971
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.