Sequence 1: | NP_648451.1 | Gene: | Plod / 39265 | FlyBaseID: | FBgn0036147 | Length: | 721 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079947.1 | Gene: | Ogfod2 / 66627 | MGIID: | 1913877 | Length: | 349 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 46/196 - (23%) |
---|---|---|---|
Similarity: | 78/196 - (39%) | Gaps: | 51/196 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 548 VYWFQIVSDAFCDDLVAIMEAHNGWSD---GSNNDNRLEGGYEAVPTRDIHMKQVGLERLYLKFL 609
Fly 610 QMFVRPLQERAFTGYFHNPPRALM-------------NFMVRYRPDEQPSLRPHHDSSTYTINIA 661
Fly 662 MNRAGIDYQGGGCRF---IRYNCSVTDTKK-----GWMLMHPGRLTHYHEGLLVTNGTRYIMISF 718
Fly 719 I 719 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Plod | NP_648451.1 | Glyco_tranf_GTA_type | 303..>395 | CDD:325014 | |
P4Hc | 555..719 | CDD:214780 | 45/187 (24%) | ||
Ogfod2 | NP_079947.1 | P4Hc | 145..307 | CDD:214780 | 45/189 (24%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1971 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |