DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plod and CG31915

DIOPT Version :9

Sequence 1:NP_648451.1 Gene:Plod / 39265 FlyBaseID:FBgn0036147 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_723087.1 Gene:CG31915 / 319025 FlyBaseID:FBgn0051915 Length:612 Species:Drosophila melanogaster


Alignment Length:491 Identity:118/491 - (24%)
Similarity:191/491 - (38%) Gaps:141/491 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 VCLLCQENLLDLEETNLPVISLALMVTQPVPFFDQFLEGIESLNYPKEKLHLLI---YSNVAFHD 328
            ||:..|:. .|.:|:  |.:.:||:|.........||..:|..:||||::.:.:   :||    |
  Fly    16 VCISGQDE-EDYQES--PTVLIALLVRNKAHILPMFLSYLEQQDYPKERIAIWLRCDHSN----D 73

  Fly   329 DDI-------------------------KSFVNKHAK-EYATAKF--ALSTDELDERQGRQLALD 365
            |.|                         :||||..:. |:..::|  .::..|...:.||.:   
  Fly    74 DSIELLRQWLDNSGDLYHSVSYEFKPEEQSFVNGTSPYEWPASRFKHLIALKEEAFQYGRDI--- 135

  Fly   366 KARLHQSDYIFFVDADAHIDDGEVLRELLRLNKQFVAPIFSKHKELWSNFWGALSEGGYYARSHD 430
                 .:||:||:|||..:...:.|:.|.||....|||:... :.|:||||..::|..||.|:.:
  Fly   136 -----WADYVFFLDADVLLTSKDSLKVLTRLQLPIVAPMLIS-ESLYSNFWCGMTEDYYYRRTDE 194

  Fly   431 YVDI--VKRELIGMFNVPHVTSIYL-------VKKTAFDAISF----KHKEFDP--------DMA 474
            |.:|  ||::  |.|.||.|.:..|       |:...||....    |.::.:|        .:.
  Fly   195 YKEIYHVKKQ--GSFPVPMVHTAVLVNMNHRAVRNLTFDRNKLVELQKSRQQEPLYDGPADDIIV 257

  Fly   475 MCESLRNAGIFMYASNLRIFGHLVNADDFNTTVTRPDFYTLFSNEIDWTEKYIHPNYSLQLNESN 539
            ...|..::||.::..|...||:::...:...|:.. |...|.:.:            |:.:||..
  Fly   258 FAISANSSGIPLHICNDITFGYILQPLEPGDTLDH-DVQQLVNLK------------SIMVNELG 309

  Fly   540 KIQQPCPDVYWF----QIVSDAFCDDLVAI-----------MEAHNGWSDGSNNDNRL--EGGYE 587
            .: .|..|.|..    ...|....|.:..|           ||             ||  |.|.|
  Fly   310 AV-PPLLDYYKHLEKKPEKSKLSLDRIFMINLKRRPERREKME-------------RLFDEIGIE 360

  Fly   588 AVPTRDIHMKQVGLERLY---LKFLQMFVRPLQERAFT----GYF---HNPPRALMNFMVRYRPD 642
            |.....:..|::..|||.   ::||..:..|...||.|    |.|   :|    :...|||.:..
  Fly   361 AEHFPAVDGKELSTERLLEMGVRFLPGYEDPYHHRAMTMGEIGCFLSHYN----IWVMMVRKQLK 421

  Fly   643 E----------QPSLRPHHDSSTYTINIAMNRAGID 668
            |          :|..|   .::...:|.|.|.|..|
  Fly   422 EVLILEDDIRFEPYFR---QNAVRILNQARNAAQYD 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlodNP_648451.1 Glyco_tranf_GTA_type 303..>395 CDD:325014 29/122 (24%)
P4Hc 555..719 CDD:214780 35/147 (24%)
CG31915NP_723087.1 Glyco_tranf_GTA_type 32..>146 CDD:299700 29/125 (23%)
Glyco_transf_25 334..515 CDD:133474 33/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10730
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.