| Sequence 1: | NP_648450.3 | Gene: | nkt / 39264 | FlyBaseID: | FBgn0036146 | Length: | 162 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_053585.1 | Gene: | NRG2 / 9542 | HGNCID: | 7998 | Length: | 858 | Species: | Homo sapiens |
| Alignment Length: | 75 | Identity: | 23/75 - (30%) |
|---|---|---|---|
| Similarity: | 40/75 - (53%) | Gaps: | 4/75 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 76 LGHKIAFLC-VAKGNPRPHITWYKDGAEIYQHLYMHVHEWRIGDDKVKSKIEIDPATQMDAGLYE 139
Fly 140 CTADNMYSID 149 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| nkt | NP_648450.3 | Ig_3 | 75..144 | CDD:464046 | 21/68 (31%) |
| NRG2 | NP_053585.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..96 | ||
| Ig_Pro_neuregulin | 237..328 | CDD:409408 | 23/75 (31%) | ||
| putative Ig strand A | 237..243 | CDD:409408 | |||
| Ig strand B | 253..257 | CDD:409408 | 0/3 (0%) | ||
| Ig strand C | 267..271 | CDD:409408 | 0/3 (0%) | ||
| Ig strand E | 294..298 | CDD:409408 | 1/3 (33%) | ||
| Ig strand F | 308..313 | CDD:409408 | 2/4 (50%) | ||
| Ig strand G | 321..324 | CDD:409408 | 23/75 (31%) | ||
| Neuregulin | 438..839 | CDD:426627 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 500..543 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 574..593 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 655..689 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 708..796 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 809..858 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||