DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nkt and NRG2

DIOPT Version :10

Sequence 1:NP_648450.3 Gene:nkt / 39264 FlyBaseID:FBgn0036146 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_053585.1 Gene:NRG2 / 9542 HGNCID:7998 Length:858 Species:Homo sapiens


Alignment Length:75 Identity:23/75 - (30%)
Similarity:40/75 - (53%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LGHKIAFLC-VAKGNPRPHITWYKDGAEIYQHLYMHVHEWRIGDDKVKSKIEIDPATQMDAGLYE 139
            :|.|.:..| .|.|||:|...|:|||.|:.:...:.:   :.|:.:..|:::.:.....|||.|.
Human   249 VGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRI---KYGNGRKNSRLQFNKVKVEDAGEYV 310

  Fly   140 CTADNMYSID 149
            |.|:|:...|
Human   311 CEAENILGKD 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nktNP_648450.3 Ig_3 75..144 CDD:464046 21/68 (31%)
NRG2NP_053585.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96
Ig_Pro_neuregulin 237..328 CDD:409408 23/75 (31%)
putative Ig strand A 237..243 CDD:409408
Ig strand B 253..257 CDD:409408 0/3 (0%)
Ig strand C 267..271 CDD:409408 0/3 (0%)
Ig strand E 294..298 CDD:409408 1/3 (33%)
Ig strand F 308..313 CDD:409408 2/4 (50%)
Ig strand G 321..324 CDD:409408 23/75 (31%)
Neuregulin 438..839 CDD:426627
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..543
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..593
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 655..689
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..796
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 809..858
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.