DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment nkt and PTPRS

DIOPT Version :9

Sequence 1:	NP_648450.3	Gene:	nkt / 39264	FlyBaseID:	FBgn0036146	Length:	162	Species:	Drosophila melanogaster
Sequence 2:	NP_002841.3	Gene:	PTPRS / 5802	HGNCID:	9681	Length:	1948	Species:	Homo sapiens

Alignment Length:	71	Identity:	22/71 - (30%)
Similarity:	35/71 - (49%)	Gaps:	5/71 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    75 VLGHKIAFLCVAKGNPRPHITWYKDGAEIYQHLYMHVHEWRIGDDKVKSKIEIDP-ATQMDAGLY 138
            |.|...:|:|.|.|:|:|.:||.|.|.::....:..:.    .|:...:.:.|.| .|..|..:|
Human    45 VSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIE----FDESAGAVLRIQPLRTPRDENVY 105

  Fly   139 ECTADN 144
            ||.|.|
Human   106 ECVAQN 111

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
nkt	NP_648450.3	Ig	82..154	CDD:143165	20/64 (31%)
PTPRS	NP_002841.3	Ig	32..120	CDD:299845	22/71 (31%)
		I-set	33..124	CDD:254352	22/71 (31%)
		Important for binding to glycosaminoglycan chains. /evidence=ECO:0000250\|UniProtKB:B0V2N1	68..72		2/3 (67%)
		IG_like	141..234	CDD:214653
		Ig2_RPTP_IIa_LAR_like	152..235	CDD:143215
		IG_like	251..328	CDD:214653
		Ig3_RPTP_IIa_LAR_like	259..327	CDD:143216
		FN3	332..421	CDD:238020
		FN3	428..520	CDD:238020
		FN3	525..613	CDD:238020
		FN3	621..715	CDD:238020
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	700..724
		FN3	723..828	CDD:238020
		FN3	838..920	CDD:238020
		FN3	932..1029	CDD:238020
		FN3	1037..>1097	CDD:238020
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1311..1340
		PTPc	1392..1647	CDD:214550
		PTPc	1418..1647	CDD:238006
		Substrate binding. /evidence=ECO:0000250	1589..1595
		PTPc	1679..1938	CDD:214550
		PTPc	1708..1938	CDD:238006
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910