DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nkt and ptk7a

DIOPT Version :9

Sequence 1:NP_648450.3 Gene:nkt / 39264 FlyBaseID:FBgn0036146 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001018501.1 Gene:ptk7a / 553690 ZFINID:ZDB-GENE-050522-216 Length:231 Species:Danio rerio


Alignment Length:88 Identity:25/88 - (28%)
Similarity:39/88 - (44%) Gaps:14/88 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NGAKILQASHFDLEYVLGHKIAFLCVAKGNPRPHITWYKDGAEIYQHLYMHVHEWRIGDDKVKSK 124
            :||..|::.....|.....::...|...|:|||...|:|||.:|.:..|           |:.:|
Zfish   130 SGAVSLKSPESVAEIQSSSQVILRCNIDGHPRPTNRWFKDGTQITEKNY-----------KINNK 183

  Fly   125 ---IEIDPATQMDAGLYECTADN 144
               :.:..|:..|.|||.|.|.|
Zfish   184 ERSLTLPNASPDDNGLYFCCAKN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nktNP_648450.3 Ig 82..154 CDD:143165 21/66 (32%)
ptk7aNP_001018501.1 I-set 37..120 CDD:254352
Ig 42..122 CDD:299845
Ig 150..222 CDD:299845 21/68 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.