DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nkt and CG7607

DIOPT Version :9

Sequence 1:NP_648450.3 Gene:nkt / 39264 FlyBaseID:FBgn0036146 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_648449.1 Gene:CG7607 / 39263 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster


Alignment Length:152 Identity:79/152 - (51%)
Similarity:107/152 - (70%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVCLALGLLMLATPVCEARRGRGRGRTKSRVQIG-LPITGKYRDPESDQYYNNNNGAKILQASHF 70
            ||.|.|..|:....:..|.:....|:|:.|...| .|:..::|..::..||::.|||||:::|||
  Fly    11 IVLLCLCFLIFGDLIYIAAQRSTAGKTERRNYTGKKPVVIQHRSQDAVNYYDHENGAKIIKSSHF 75

  Fly    71 DLEYVLGHKIAFLCVAKGNPRPHITWYKDGAEIYQHLYMHVHEWRIGDDKVKSKIEIDPATQMDA 135
            :|:|.||.||.|.|:|:|||||.|||:|||||:|||.:..|||..|..:.||||:||||.|||||
  Fly    76 ELDYTLGRKITFFCMAQGNPRPTITWFKDGAELYQHRFFQVHESHIEANIVKSKMEIDPTTQMDA 140

  Fly   136 GLYECTADNMYSIDRRSFKTDF 157
            |.|||.|||:|:||||.|:||:
  Fly   141 GFYECQADNIYAIDRRGFRTDY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nktNP_648450.3 Ig 82..154 CDD:143165 48/71 (68%)
CG7607NP_648449.1 Ig_3 70..149 CDD:404760 50/78 (64%)
Ig strand B 85..89 CDD:409353 2/3 (67%)
Ig strand C 98..102 CDD:409353 2/3 (67%)
Ig strand E 123..132 CDD:409353 4/8 (50%)
Ig strand F 142..147 CDD:409353 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I5611
eggNOG 1 0.900 - - E1_2C1RV
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I3548
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1418131at2759
OrthoFinder 1 1.000 - - FOG0008347
OrthoInspector 1 1.000 - - otm14697
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10009
87.870

Return to query results.
Submit another query.