DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nkt and boc

DIOPT Version :10

Sequence 1:NP_648450.3 Gene:nkt / 39264 FlyBaseID:FBgn0036146 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001005393.1 Gene:boc / 334628 ZFINID:ZDB-GENE-030131-6560 Length:1032 Species:Danio rerio


Alignment Length:68 Identity:25/68 - (36%)
Similarity:36/68 - (52%) Gaps:9/68 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GHKIAFLCVAKGNPRPHITWYKDGAEIYQHLYMHVHEWRIGDDKVKSKIEIDPATQMDAGLYECT 141
            |.::...|||.|.|.|.:||.|||.::..|     :..|.    :.|.:.||.|::.|:|.|.|.
Zfish   250 GQRLVLECVASGIPTPQVTWAKDGLDLRNH-----NNTRF----LLSNLLIDAASESDSGTYVCL 305

  Fly   142 ADN 144
            |||
Zfish   306 ADN 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nktNP_648450.3 Ig_3 75..144 CDD:464046 23/66 (35%)
bocNP_001005393.1 Ig_3 40..114 CDD:464046
Ig 143..209 CDD:472250
Ig strand B 151..155 CDD:409358
Ig strand C 165..169 CDD:409358
Ig strand E 188..192 CDD:409358
Ig strand F 202..207 CDD:409358
Ig 242..314 CDD:472250 25/68 (37%)
Ig strand B 253..257 CDD:409394 0/3 (0%)
Ig strand C 266..270 CDD:409394 1/3 (33%)
Ig strand F 301..306 CDD:409394 2/4 (50%)
I-set 328..411 CDD:400151
Ig strand B 345..349 CDD:409549
Ig strand C 358..362 CDD:409549
Ig strand E 379..383 CDD:409549
Ig strand F 393..398 CDD:409549
Ig strand G 406..409 CDD:409549
fn3 481..548 CDD:394996
FN3 <561..>794 CDD:442628
FN3 579..674 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.