| Sequence 1: | NP_648450.3 | Gene: | nkt / 39264 | FlyBaseID: | FBgn0036146 | Length: | 162 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001005393.1 | Gene: | boc / 334628 | ZFINID: | ZDB-GENE-030131-6560 | Length: | 1032 | Species: | Danio rerio |
| Alignment Length: | 68 | Identity: | 25/68 - (36%) |
|---|---|---|---|
| Similarity: | 36/68 - (52%) | Gaps: | 9/68 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 77 GHKIAFLCVAKGNPRPHITWYKDGAEIYQHLYMHVHEWRIGDDKVKSKIEIDPATQMDAGLYECT 141
Fly 142 ADN 144 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| nkt | NP_648450.3 | Ig_3 | 75..144 | CDD:464046 | 23/66 (35%) |
| boc | NP_001005393.1 | Ig_3 | 40..114 | CDD:464046 | |
| Ig | 143..209 | CDD:472250 | |||
| Ig strand B | 151..155 | CDD:409358 | |||
| Ig strand C | 165..169 | CDD:409358 | |||
| Ig strand E | 188..192 | CDD:409358 | |||
| Ig strand F | 202..207 | CDD:409358 | |||
| Ig | 242..314 | CDD:472250 | 25/68 (37%) | ||
| Ig strand B | 253..257 | CDD:409394 | 0/3 (0%) | ||
| Ig strand C | 266..270 | CDD:409394 | 1/3 (33%) | ||
| Ig strand F | 301..306 | CDD:409394 | 2/4 (50%) | ||
| I-set | 328..411 | CDD:400151 | |||
| Ig strand B | 345..349 | CDD:409549 | |||
| Ig strand C | 358..362 | CDD:409549 | |||
| Ig strand E | 379..383 | CDD:409549 | |||
| Ig strand F | 393..398 | CDD:409549 | |||
| Ig strand G | 406..409 | CDD:409549 | |||
| fn3 | 481..548 | CDD:394996 | |||
| FN3 | <561..>794 | CDD:442628 | |||
| FN3 | 579..674 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||