powered by:
Protein Alignment nkt and Ptprd
DIOPT Version :9
Sequence 1: | NP_648450.3 |
Gene: | nkt / 39264 |
FlyBaseID: | FBgn0036146 |
Length: | 162 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038967340.1 |
Gene: | Ptprd / 313278 |
RGDID: | 1561090 |
Length: | 1940 |
Species: | Rattus norvegicus |
Alignment Length: | 71 |
Identity: | 27/71 - (38%) |
Similarity: | 36/71 - (50%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 VLGHKIAFLCVAKGNPRPHITWYKDGAEIYQHLYMHVHEWRIGDDKVKSKIEIDP-ATQMDAGLY 138
|.|...:|:|.|.|:|||.|.|.|.|.::....:..|.|: ||...|.:.|.| .|..|..:|
Rat 43 VSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVVIEF---DDGSGSVLRIQPLRTPRDEAIY 104
Fly 139 ECTADN 144
||.|.|
Rat 105 ECVASN 110
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.