DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nkt and oig-4

DIOPT Version :9

Sequence 1:NP_648450.3 Gene:nkt / 39264 FlyBaseID:FBgn0036146 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001022278.1 Gene:oig-4 / 259448 WormBaseID:WBGene00043050 Length:155 Species:Caenorhabditis elegans


Alignment Length:138 Identity:51/138 - (36%)
Similarity:85/138 - (61%) Gaps:6/138 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EARRGR--GRGRTKSRVQIGLPITGKYRDPESDQYYNNNNGAKILQASHFDLEYVLGHKIAFLCV 85
            ::|.||  |:|:.||.:|...  ..::...::  ..::|..|:|:..|||...|.||:|:..:|.
 Worm    21 DSRGGRRGGKGKGKSNLQFAQ--VAEFSLVQT--VLSDNRSAQIITGSHFSQTYRLGYKLLIICK 81

  Fly    86 AKGNPRPHITWYKDGAEIYQHLYMHVHEWRIGDDKVKSKIEIDPATQMDAGLYECTADNMYSIDR 150
            |:|:|||.|.|||:||||.....:|.:|..|.:|.:.||:|:||||..|.|:|.|.|:|.:.:..
 Worm    82 ARGDPRPTIKWYKEGAEIQPKASIHYYEKPIENDTIWSKLEVDPATMGDQGVYACVANNPHGVMA 146

  Fly   151 RSFKTDFS 158
            ::||.:::
 Worm   147 KNFKAEYT 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nktNP_648450.3 Ig 82..154 CDD:143165 31/71 (44%)
oig-4NP_001022278.1 Ig 76..150 CDD:143165 31/73 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I5611
eggNOG 1 0.900 - - E1_2C1RV
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I3548
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28869
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008347
OrthoInspector 1 1.000 - - otm14697
orthoMCL 1 0.900 - - OOG6_119344
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16991
SonicParanoid 1 1.000 - - X10009
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.